KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3411Help
Entry
Rleg2_3411        CDS       T00779                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rleg2_3411
   00051 Fructose and mannose metabolism
    Rleg2_3411
Enzymes [BR:rlt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Rleg2_3411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3525004..3526314)
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIQKVKYEGPDSTNPLAFRYYQPDEIVMGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFLRPWFEDTMKAAKLKADVAFEFFSLLGSPYYCFHDADVRPEGKNFAENTKNLNE
IVDYFAEKQASTGTKLLWGTANLFSNRRYMSGAATNPDPDVFAFAAATVKTCIDATQKLG
GENYVLWGGREGYETLLNTDLKRELDQLGRFLNLVVEYKHKIGYTGTILIEPKPQEPTKH
QYDYDVATVYGFLKKHGLENEVKLNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKTGGTNFDSKLRRQSLDPADLLIGHIGGMD
CCARGLKAAARMIEDKALSQPLADRYAGWESAEAQKLFRGEYSLDEITNWVETKDVNPQP
RSGKQELLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggatttttcggcgatatccaaaaagtgaaatacgaaggccctgacagcacc
aatccgctggccttccgttactaccagccggacgagatcgtcatgggcaagcgcatggaa
gaccatctgcgctttgcggtggcctattggcacaccttcacctggccgggcggcgatccc
ttcggcggccagaccttcctgcgtccctggttcgaggacacgatgaaggccgccaagctc
aaggctgacgtcgccttcgaattcttctcgctgcttggctcgccctactactgcttccat
gatgccgacgtgcgtccggagggcaaaaatttcgctgagaacaccaaaaacctcaacgag
atcgtcgactacttcgccgagaagcaggcttccaccggcaccaagctgctctggggcacg
gcgaacctcttttccaaccgccgttacatgtcgggtgctgcgaccaatccggatcccgat
gtcttcgctttcgcagccgcgaccgtgaagacctgcatcgacgcgacgcagaagctcggc
ggtgagaactatgtgctctggggcggccgcgaaggttacgagacgctgctcaataccgat
ctcaagcgggagctcgaccagctcgggcgcttcctcaacctcgtcgtcgaatacaagcac
aagatcggctacaccggcacgatcctgatcgagccgaagccgcaggagccgaccaagcac
cagtatgattacgacgttgcgaccgtctacggcttcctcaagaagcacggcctcgaaaac
gaagtgaagctcaatatcgagcagggccacgcgatcctggccggtcactccttcgagcac
gaactggcgcttgccaatgcgcttggcatcttcggctcgatcgatatgaaccgcaacgac
taccagtccggctgggataccgaccagttcccgaacaatgttcccgaaatggcgctcgcc
tattatcacgttctggcaggcggcggcttcaagaccggcggcaccaacttcgactcgaag
cttcgccgccagtcgctcgacccggcggatctgctgatcggccatatcggcggcatggat
tgctgcgcccgcggcctgaaggccgctgccagaatgatcgaggacaaggctctgtcacag
ccgctcgccgatcgttatgccggctgggaatccgccgaggcgcagaagctcttccgcggc
gaatattcgctggacgagattacgaactgggtcgagaccaaggacgtcaacccgcagccg
agatccggcaagcaggaactgctcgaaaacgtcgtcaaccgttacgtctga

DBGET integrated database retrieval system