KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3454Help
Entry
Rleg2_3454        CDS       T00779                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00511  Other glycan degradation
rlt00520  Amino sugar and nucleotide sugar metabolism
rlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg2_3454
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rleg2_3454
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rleg2_3454
Chaperones and folding catalysts [BR:rlt03110]
 Intramolecular chaperones
  Others
   Rleg2_3454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ACI56721
JGI: Rleg23454
UniProt: B5ZQZ9
Position
complement(3569716..3571626)
Genome map
AA seq 636 aa AA seqDB search
MADYSLETSWRPVEGSFGRLTFTLHNLSAEPLSGFSLAYTSETRVADKHVCDGASLKRQV
AHFHEFLPSEQLTVPPGGRWRFTVEGLSREPKHVTAGVKSAYLTLADGRHLPVDFGDLML
EGRDGGVSPPLLPPGKADEPYALLPWPLALGLKAGDLPATLYPAERTRPDAIEALSQVLS
LYQRLYPVEDAPFSLRAVEGGRRIRFVAESSIAAFAYELRFTAHEIVLSSADEAGRRYGL
ISLAQLLHGARADGERFKFPNFGTIADQPRYDWRGCHLDVSRQFYPVADILRLIDILAWN
KLNIFHWHLTDDEAWRLEIKAYPALTEIGARRGPDEVLVPQLGDGAETRAGHYTQDDIRR
IVAHAASLGVEVVPEIDIPGHSTATLLSLPELADGQEAPDSYRAVQGYPNNALNPAVEFT
YEFLGKVFDEIVALFPSEYLHIGGDEVAEGAWLSSPLCQALMKREKLAGTAELQSYFLKR
IKAMLSERGRKLAGWNEVSHGGGIDPDGTLLMAWEKPAVGIELAQQGYDVVMTPGQAYYL
DMAQAEAWAEPGAAWAGYSPPEHSYTYEAEGELPEALQEKMRGIQACIWTENFISRAYFN
RLVFPRLPAVAEAAWTPSGRKDWDRFAAIVRMWPML
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggccgattatagtcttgagacaagctggcgcccggtcgaaggcagcttcgggcgcttg
accttcacgctccacaatctttcggccgagccgctgtccggcttctcgcttgcctataca
tcggagacgcgggttgccgacaagcatgtctgcgacggcgccagcctcaagcggcaggtc
gcgcatttccatgagttcctgccgtccgagcaattgacggtgccgccgggtgggcgctgg
cggttcactgtggaggggctgagccgagagccgaaacatgtcaccgctggcgttaaatcc
gcctatctgacacttgccgacggtcgtcaccttcccgtcgatttcggcgatctcatgctc
gaaggccgggatggcggtgtgtcgccgccgctcttgccgccggggaaagccgatgaaccc
tatgcgctgctcccctggccgctggcgctcgggctgaaggcgggtgacttgccggccacc
ctctatccggccgagaggacgcggcctgatgcgatcgaggccctctcccaggttctttct
ctttaccagcgcctctacccagtcgaagacgcgccgttttcgctgagggccgtcgaaggc
ggacggcgcattcgtttcgtcgccgaatcgtcgatcgctgccttcgcctacgagctgcgt
ttcaccgcgcacgagatcgtgctttcgagcgccgatgaagcggggcggcgctacggtctc
atcagcctggcgcagctgctgcacggggcccgcgccgatggcgaacgatttaaattcccc
aatttcggcacgatcgccgaccagccgcgttatgactggcgcggctgccatctcgatgtg
tcccggcagttctatccggtcgccgacatcctgcggctgatcgatattcttgcctggaac
aagctcaatatctttcattggcacctgaccgacgacgaagcctggcggctggagatcaag
gcctatccagcgctgacggagatcggcgcgcggcgcgggccggacgaggtcctcgtgcca
cagctcggcgacggagcggaaacacgcgccggccattacacgcaggatgatatcaggcgg
atcgttgcgcatgccgcctcgctcggtgtcgaggtcgtgccggaaatcgacattcccggc
cacagcaccgcaaccttgctctcgctgcccgagctcgccgacgggcaggaagcgccggac
agctatcgcgcggtccaaggttatcccaacaatgcgctcaaccctgcggtcgaattcacc
tatgaatttctcggcaaggtgttcgacgagatcgtggcgctgtttccgagcgagtatctc
cacattggcggcgacgaggtggcagagggcgcttggctatcctcccctctctgccaggcg
ctgatgaagcgggagaagcttgccggcaccgccgagctgcaatcctatttcctgaaacgc
atcaaggcgatgctctcggagcgcggcaggaagctcgccggctggaacgaggtctcgcat
ggcggcggcatcgaccccgacggcacgctgctgatggcctgggaaaagcccgccgtcggc
atcgagctggcgcagcaaggctacgacgtggtgatgacgccgggacaggcttattatctc
gacatggcgcaggccgaagcctgggcggagcccggtgcagcatgggcgggctattcgccg
ccggaacatagctacacttacgaggccgagggtgagttgccggaggcgctgcaggagaag
atgcgcggtatccaggcctgcatctggactgaaaacttcatctcacgcgcctatttcaac
cggctggtctttccgcgtcttccggccgtcgccgaggccgcatggacaccgtcgggccgg
aaggattgggaccggttcgccgcgatcgtgcggatgtggcctatgctttag

DBGET integrated database retrieval system