KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3487Help
Entry
Rleg2_3487        CDS       T00779                                 

Definition
family 2 glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rlt00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rlt00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rlt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3603007..3605253
Genome map
AA seq 748 aa AA seqDB search
MRSVVSFNEGWSFHEGFGQRLLESFDAAKSVSLPHTAVELPFNYFDEKSYQRAFTYQKVL
RWLPEFEGREVSLVFDAAMADSVVYLNGEEIIAHKDGYTPFEARLTGKLVKGENLVTVKI
DGSENPEIPPFGGRIDYLTYAGIYRDVWLKVTDPVSIRNLKIETADVLAPEKSATIRVDI
ANPDGRSFSATVTATLKQADGTVIATAATETIGDRTRLSFGGLTGITLWDITDPTLYDVT
VELRTEHGSDRISTRFGFRTAEFTPEGFLLNGKPLKLRGLNRHQSFPYVGYAAGRSAQER
DADIMKTVLKCNIVRTSHYPQSKWFLDRCDAIGLLVFEEIPGWQHIGDADWQKESIENVR
RMIERDWNHPSIIIWGVRINESQDSHDFYVETNRLARELDSTRQTGGVRYITESELLEDV
YTMNDFILGNEELPGANRPRTALRGQEENTGLSRKVPYLITEFNGHMHPTKIYDQEQRQA
EHVRRHLEVLNAAYGDPDISGAIGWCMFDYNTHKDFGSGDRICYHGVMDMFREPKFAAYA
YISQCDPSDEIVMKPVTFWARGERNIGGVLPLIILTNCDEVELQYGGLSKRIGPDRENYP
HLPHPPVVLDHRHFTADELGTWGLEWIDGTLTGYIGGEPVTSLTFAADPLPTTLEIVADS
HTLRARERDSTRVIIRALDQCGQRLPFMNDSISLKVHGPAKIVGPANVPLQGGTAGFWLE
ATGMVGEITIEAVSSRFPPVTLNVTAAA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgtcgtttccttcaacgaaggctggagtttccatgagggcttcggacagcgt
ctgctcgaaagcttcgacgccgccaagtcggtcagcctgccccataccgccgtcgaactg
cctttcaactatttcgacgaaaagagctatcagcgcgccttcacctatcaaaaggtgctg
cgctggctgccggaattcgagggccgcgaggtgtcgctcgtcttcgacgccgccatggcc
gacagcgtcgtctacctcaacggcgaagagatcatcgcccataaggacggctacaccccc
ttcgaggctcgcctcaccggcaagctcgtcaagggcgagaacctggtgacggtcaagatc
gacggcagcgaaaaccctgagatcccgcccttcggcggccgcatcgattatctgacttat
gccggcatctaccgcgacgtctggctgaaggtcaccgaccccgtctcgatccgcaatctc
aagatcgaaaccgcagacgttcttgccccggaaaaatcggcaaccatccgtgtcgatatc
gccaaccccgatggccgcagcttctcggcaaccgtcaccgccacgctgaagcaggcagac
ggcacggtgatcgccaccgcagcaaccgagacgatcggcgaccgcaccaggctttctttc
ggcggcctcaccggcatcacgctctgggacattaccgatcccaccctctacgacgtcacc
gtcgaactcaggaccgagcacggctccgaccgtatctccacccgcttcggcttccgcacc
gctgaattcaccccggaaggtttccttctcaacggcaagccgctgaagctgcgcggcctc
aaccgccaccagtccttcccctatgtcggttatgccgccggccgctccgcccaggagcgt
gacgccgacatcatgaagacggtgctgaagtgcaatatcgtccgcacctcgcattatccg
caatcgaaatggttcctcgaccgctgcgacgccatcggcctgctggttttcgaggaaatc
cccggctggcagcatatcggcgatgccgactggcagaaggaatcgatcgaaaacgtccgc
cggatgatcgagcgcgactggaaccatccctcgatcatcatctggggcgtgcgcatcaac
gagtcccaggatagtcacgatttctacgtcgagaccaatcgcctcgcccgtgagctcgac
agcacccgccagaccggcggcgtgcgttacatcaccgagagcgagctgctcgaagacgtc
tacacgatgaatgacttcatcctcggcaacgaggagctgccgggcgccaaccgcccgcgc
accgcattgcgcggccaggaggaaaataccggtctgtcccggaaggtgccgtacctcatc
accgagttcaacggccacatgcatccgacgaaaatctacgaccaggagcagcgccaggcc
gagcatgtgcgccgtcacctggaggtgctgaatgccgcctatggcgatcccgatatctcc
ggcgccatcggctggtgcatgttcgattacaacacccacaaggatttcggctccggcgac
cgcatctgctatcacggcgtcatggacatgttccgcgaaccgaaattcgcggcctatgcc
tatatcagccagtgcgacccgtccgacgagatcgtcatgaagccggtgaccttctgggcc
cgcggcgagcgcaatatcggcggcgtgctgccgctgatcatcctgaccaattgcgacgag
gtggaactgcaatatggcgggctcagcaagcgcatcggcccggaccgcgagaactatccg
catctgccgcatccgcctgtcgtgctcgatcatcgccacttcaccgccgatgaactcggc
acctggggtctggaatggatcgacggcaccttgaccggctatatcggcggcgagccggtg
acgagcctgacctttgccgccgatcccttgccgacgacgctggaaatcgtcgccgacagc
cacacgctgagggcgcgcgaacgcgacagcacccgcgtcatcattcgcgccctcgaccag
tgcggccagcgcctgccattcatgaacgacagcatttcgctgaaggtgcatgggcccgca
aagatcgtcggcccggccaatgtgccgctacagggcggtaccgcgggcttctggctggag
gcgacggggatggtcggcgagatcacgatcgaagcggtctcctcgcgtttccccccggtg
accctcaatgtgacggccgccgcctga

DBGET integrated database retrieval system