KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3617Help
Entry
Rleg2_3617        CDS       T00779                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rleg2_3617
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rleg2_3617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3737696..3738883
Genome map
AA seq 395 aa AA seqDB search
MTGKTAPRRLSIFGSTGSIGQNTLNVVDHLGGRENFEISVLTGNGNVELLARQAKDFGAR
MAVTANDRHYEALKSALSGSGIAVASGKSGLMEAADRGADWVMAAIVGTAGLAPTLAAAK
RGADIALANKECLVSAGDLFISAIRKGGGRLLPVDSEHNAIFQVLEENQRHAIERVVLTA
SGGPFRTASLKEMAGVTAETARAHPNWSMGLKISIDSASMFNKALEMIEARHLFGLTPEQ
IEVIIHPQSIIHSMVGYTDGSVLAQLGAPDMRTAIGYALSFPRRPNLPIERLDFAKLARL
DFEAPDELRFPALRLARLAMTRGGVQGAVLNGAKEVALEAFIEGRLPFLAMAEITERVMD
DLAGLPPAEDMDDVFAADRQARQRAADLMKLEIAG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaaaccgcgccgcggcgcctcagcatcttcggctcgaccggctcgatcggc
cagaacactctcaatgtcgtcgatcacctgggcggacgggagaatttcgaaatttccgtg
ctgaccggcaacggcaatgtcgaattgctggcccggcaggcgaaggatttcggcgcgcgg
atggcggtgacggcaaacgaccgccattacgaagcgctgaagagcgcgctttccggcagc
ggcatcgcggtcgcatccggaaaatccggcctgatggaggccgccgatcgcggagccgac
tgggtgatggcggcaatcgtcggcaccgcgggcctggcgccgacacttgccgcagcaaag
cgcggcgccgatatcgcccttgccaacaaggaatgcctggtttcggccggcgatctgttc
atcagcgccatccgcaagggcggcggcaggctgcttcccgtcgacagcgagcacaatgcg
attttccaggtgctggaggaaaaccagcgccatgccatcgagcgcgtcgtgctgacggct
tcgggcggccccttccgcaccgcctcgctgaaggagatggccggtgtgacggcggaaacc
gcgcgcgcccacccgaactggtcgatgggcctgaagatctcgatcgacagcgcctcgatg
ttcaacaaggcgcttgaaatgatcgaagcccggcatctgttcggcctgacgcccgaacag
atcgaggtcatcatccatccgcaatcgatcatccattcgatggtcggctataccgacggt
tcggtgctcgctcagctcggcgcccccgatatgcgcaccgccatcggttatgccctatcc
tttccgcgccggccgaacctgccgatcgagcggctggatttcgccaagctcgccagactc
gatttcgaggcgccggacgagctgcgatttcccgccttgcggctggcgcgcctggcgatg
acgcgcggcggtgttcagggcgcggtgctgaacggcgccaaggaagtggcgctcgaagcc
ttcatcgaagggcggctgcccttcctcgccatggccgagatcaccgaaagggtcatggac
gatctggccggcctgccgccggctgaagacatggacgatgtcttcgccgccgaccggcag
gccaggcagagggcagcggatctgatgaagctggagatcgccggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system