KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3629Help
Entry
Rleg2_3629        CDS       T00779                                 

Definition
(GenBank) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg2_3629
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rleg2_3629
   00330 Arginine and proline metabolism
    Rleg2_3629
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rleg2_3629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3757616..3758551
Genome map
AA seq 311 aa AA seqDB search
MNAQSQSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADLGDLRIVPAMD
LPNHPKAHNLRTVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPRDRAFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIMREILDVVAKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARVLVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccaatcgcaatctgtcacccttatcggcgcgccgctggaagaaggctccggc
cgcaggggcgcggccatgggcccggcggccctgcgcatcgccggcgtcgatcagacgttg
atcgagctcggccacgacgtcgccgatctcggcgatctcaggatcgtaccggcgatggat
ctaccgaatcatccgaaggcccataatctgagaaccgtcggcgccttcacgcgggcgctc
gaaagcagcgtccatgacgtcgccgcctcgggccgctttccgctcattctcggcggcgac
cacagcctctccatgggcagtgtctccggcatggcgcgttacgccgccggcaagggccgc
ccgcttttcgtgctctggctcgatgcccatgccgatttcaactctccggccacttcgcct
tccggcaatattcacggcatgcccgtcgcgttcttctgcggcgaggcggagttcgccgag
atcctgccgagggatcgtgccttcgtcgacccgaagaatgtcttccaggtcggcatccgt
tcggtcgatgcgcgtgagcgcgaggaaatccacgaacacggcgtcaacgtcttcgatatg
cgcgcgatcgacgagcagggcatcggcgccatcatgcgtgagatcctcgatgtggtcgcc
aaggcgaacggcctgctgcatgtcagcctcgatctcgatttcctcgatcccgaaattgcc
cccggcgtcggcacgacggtgcctggcggcgcgaccttccgcgaggcgcatctggtgatg
gaaatgctgtccgacagcggcctcgtctcgtcgctcgatctcgtcgaactcaatccgttt
ctcgacgatcgcggcaagagcgcccgcgtcctggtggaactgacggcaagcctcttcggc
cgccgcatcttcgatcgcccaacccgcgccgcatag

DBGET integrated database retrieval system