KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3629Help
Entry
Rleg2_3629        CDS       T00779                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg2_3629
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg2_3629
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rleg2_3629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3757616..3758551
Genome map
AA seq 311 aa AA seqDB search
MNAQSQSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADLGDLRIVPAMD
LPNHPKAHNLRTVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPRDRAFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIMREILDVVAKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARVLVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccaatcgcaatctgtcacccttatcggcgcgccgctggaagaaggctccggc
cgcaggggcgcggccatgggcccggcggccctgcgcatcgccggcgtcgatcagacgttg
atcgagctcggccacgacgtcgccgatctcggcgatctcaggatcgtaccggcgatggat
ctaccgaatcatccgaaggcccataatctgagaaccgtcggcgccttcacgcgggcgctc
gaaagcagcgtccatgacgtcgccgcctcgggccgctttccgctcattctcggcggcgac
cacagcctctccatgggcagtgtctccggcatggcgcgttacgccgccggcaagggccgc
ccgcttttcgtgctctggctcgatgcccatgccgatttcaactctccggccacttcgcct
tccggcaatattcacggcatgcccgtcgcgttcttctgcggcgaggcggagttcgccgag
atcctgccgagggatcgtgccttcgtcgacccgaagaatgtcttccaggtcggcatccgt
tcggtcgatgcgcgtgagcgcgaggaaatccacgaacacggcgtcaacgtcttcgatatg
cgcgcgatcgacgagcagggcatcggcgccatcatgcgtgagatcctcgatgtggtcgcc
aaggcgaacggcctgctgcatgtcagcctcgatctcgatttcctcgatcccgaaattgcc
cccggcgtcggcacgacggtgcctggcggcgcgaccttccgcgaggcgcatctggtgatg
gaaatgctgtccgacagcggcctcgtctcgtcgctcgatctcgtcgaactcaatccgttt
ctcgacgatcgcggcaagagcgcccgcgtcctggtggaactgacggcaagcctcttcggc
cgccgcatcttcgatcgcccaacccgcgccgcatag

DBGET integrated database retrieval system