KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3679Help
Entry
Rleg2_3679        CDS       T00779                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_3679
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rleg2_3679
  Amino acid metabolism
   00310 Lysine degradation
    Rleg2_3679
Enzymes [BR:rlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rleg2_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3808147..3809412)
Genome map
AA seq 421 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV
VAAGETVGLGALLGQIAEGAVAAAAPAAAAPAAAPAQPAAAAPAQPAPVAAAAASSSSAS
VSTMPPAPAASKMLAESNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAAAPAAA
RGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIF
EKKHGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVVPVI
RDADQMSIAEVEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAPQSG
ILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccgattctcgagcttgaa
accgacaaggtgaccatcgaagttccggcacccgcttccggcacgctttcggaaatcgtt
gtcgccgccggcgagaccgtcggcctcggcgcgttgctcggccagatcgccgaaggtgcc
gtcgctgctgccgcaccggctgctgccgcaccggccgccgcgcctgcccagcccgccgct
gctgctcccgctcagccggcgccggttgccgctgctgccgcatcgtcgtcgagcgcttcc
gtttccaccatgccgccggcaccggcggcttcgaagatgcttgccgaaagcaacctttcg
gccgatcaggtcgacggcagcggcaagcgcggccaggtgctgaagggtgatgtcattgct
gccgtcgccaagggcatttccgctccggctgcagcccccgccgccgctcctgccgctgcg
cgcggcccgtcgacggtcgaggatgcctcgcgcgaagagcgcgtgaagatgacgcgcctg
cgccagacgatcgccaagcgcctcaaggacgcgcagaacaccgccgcgatgcttaccacc
tataatgaggtggacatgaaggcggtcatggatctgcgcaacaagtacaaggacattttc
gagaagaaacacggcgtcaagctcggcttcatgggcttcttcacgaaagccgtcacgcat
gcgctgaaggaactgccggcggtcaatgccgagatcgacggcaccgacgtcatctacaag
aactactgccatgtcggcatggccgtcggcaccgacaagggtctcgtcgttcccgtcatc
cgcgatgccgaccagatgtcgatcgccgaagtcgagaaggaactcggccgtcttgccaag
gccgcccgtgacggctcgctctcgatggccgacatgcagggcggcaccttcaccatcacc
aatggcggcgtctacggctcgctgatgtcgtcgccgatcctcaacgcgccgcagtccggc
attctcggcatgcacaagatccaggagcggccggtggcgatcggcggtcaggtggtcatc
cgtccgatgatgtatctggcgctgtcctacgatcaccgtatcgttgacggcaaggaagcg
gtcaccttcctcgtgcgcgtcaaggagagcctggaagatccggaacgtctggttctcgat
ctctaa

DBGET integrated database retrieval system