KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3679Help
Entry
Rleg2_3679        CDS       T00779                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00020  Citrate cycle (TCA cycle)
rlt00310  Lysine degradation
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01200  Carbon metabolism
Module
rlt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rlt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rleg2_3679
  Amino acid metabolism
   00310 Lysine degradation
    Rleg2_3679
Enzymes [BR:rlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rleg2_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACI56942
JGI: Rleg23679
UniProt: B5ZSR4
Position
complement(3808147..3809412)
Genome map
AA seq 421 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV
VAAGETVGLGALLGQIAEGAVAAAAPAAAAPAAAPAQPAAAAPAQPAPVAAAAASSSSAS
VSTMPPAPAASKMLAESNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAAAPAAA
RGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIF
EKKHGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVVPVI
RDADQMSIAEVEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAPQSG
ILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccgattctcgagcttgaa
accgacaaggtgaccatcgaagttccggcacccgcttccggcacgctttcggaaatcgtt
gtcgccgccggcgagaccgtcggcctcggcgcgttgctcggccagatcgccgaaggtgcc
gtcgctgctgccgcaccggctgctgccgcaccggccgccgcgcctgcccagcccgccgct
gctgctcccgctcagccggcgccggttgccgctgctgccgcatcgtcgtcgagcgcttcc
gtttccaccatgccgccggcaccggcggcttcgaagatgcttgccgaaagcaacctttcg
gccgatcaggtcgacggcagcggcaagcgcggccaggtgctgaagggtgatgtcattgct
gccgtcgccaagggcatttccgctccggctgcagcccccgccgccgctcctgccgctgcg
cgcggcccgtcgacggtcgaggatgcctcgcgcgaagagcgcgtgaagatgacgcgcctg
cgccagacgatcgccaagcgcctcaaggacgcgcagaacaccgccgcgatgcttaccacc
tataatgaggtggacatgaaggcggtcatggatctgcgcaacaagtacaaggacattttc
gagaagaaacacggcgtcaagctcggcttcatgggcttcttcacgaaagccgtcacgcat
gcgctgaaggaactgccggcggtcaatgccgagatcgacggcaccgacgtcatctacaag
aactactgccatgtcggcatggccgtcggcaccgacaagggtctcgtcgttcccgtcatc
cgcgatgccgaccagatgtcgatcgccgaagtcgagaaggaactcggccgtcttgccaag
gccgcccgtgacggctcgctctcgatggccgacatgcagggcggcaccttcaccatcacc
aatggcggcgtctacggctcgctgatgtcgtcgccgatcctcaacgcgccgcagtccggc
attctcggcatgcacaagatccaggagcggccggtggcgatcggcggtcaggtggtcatc
cgtccgatgatgtatctggcgctgtcctacgatcaccgtatcgttgacggcaaggaagcg
gtcaccttcctcgtgcgcgtcaaggagagcctggaagatccggaacgtctggttctcgat
ctctaa

DBGET integrated database retrieval system