KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3684Help
Entry
Rleg2_3684        CDS       T00779                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00020  Citrate cycle (TCA cycle)
rlt00640  Propanoate metabolism
rlt00660  C5-Branched dibasic acid metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01200  Carbon metabolism
Module
rlt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rlt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rleg2_3684
   00640 Propanoate metabolism
    Rleg2_3684
   00660 C5-Branched dibasic acid metabolism
    Rleg2_3684
Enzymes [BR:rlt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rleg2_3684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 FimP GARS_A
Motif
Other DBs
NCBI-ProteinID: ACI56947
JGI: Rleg23684
UniProt: B5ZSR9
Position
complement(3814349..3815542)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLKGYGAPVAEGVAILKVEEAAAAAKSLPGPLYVVKSQIHAGGRGKGKFK
ELSPEAKGGVRLAKSIEEVVAHAKEMLGNTLVTAQTGDAGKQVNRLYIEDGADIARELYC
SILVDRSVGRVAFVVSTEGGMDIEAVAHDTPEKIQTIAIDPEAGVTAADVAAISKALQLD
GAAAEDAKSLFPALYKAFNEKDMALLEVNPLIVMKDGHLRVLDAKMSFDGNALFRHDDVK
TLRDETEEDAKEIEASKWDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGKEPANFCDVG
GGAGKEKVAAAFKIITADPKVEGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKILNESGLAITAADDLDDAAKKIVAAING
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaagccaaggctctgctgaagggctatggcgcgccggttgcc
gagggtgtggctattctcaaggtcgaagaggccgcggctgccgccaaatcgcttcccggt
ccgctttacgtggtcaagagccagatccatgccggcggccgcggcaagggcaagttcaag
gaactgtcgccggaggccaagggcggcgtgcgtctcgccaagtcgatcgaggaagtggtt
gcccacgccaaggaaatgcttgggaatacgctggtgacggcacagaccggcgacgccggc
aagcaggtcaaccgcctctacatcgaagacggcgccgacatcgctcgcgagctctattgc
tcgatccttgtcgaccgttcggtcggccgcgtggctttcgtggtttccacagaaggcggc
atggacatcgaggctgtcgcccatgacacgccggagaagatccagacgatcgccatcgat
ccggaagccggcgtgacggctgctgacgttgctgcgatctccaaggctctgcaactcgac
ggtgcggccgccgaagatgccaagtcgctcttcccggcgctctacaaggccttcaacgaa
aaggacatggcgctgctcgaggtcaatccgctgatcgtcatgaaggacggtcacctgcgg
gttctcgacgccaagatgtccttcgacggcaatgcgctcttccgtcacgacgacgtcaag
acgctgcgcgacgaaaccgaagaagacgccaaggaaatcgaggcctcgaagtgggacctc
gcctatgtcgcgctcgacggcaatatcggctgcatggtcaacggcgccggccttgccatg
gcgacgatggatattatcaagctctacggcaaggagccggctaacttctgcgacgtcggc
ggcggcgccggcaaggagaaggttgctgcggctttcaagatcatcaccgcggaccccaag
gtcgaaggcattctcgtcaacatcttcggcggcatcatgaagtgcgatgtcatcgccgag
ggcgtcattgccgcggtcaaggaagtcggtctcaaggttccgctcgtcgtgcgccttgaa
ggcaccaatgtcgaactcggcaagaagatcctgaacgagtcgggtctggcgatcacggcg
gctgacgacttggacgatgcggccaagaagatcgtcgcggcgattaacggctga

DBGET integrated database retrieval system