KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3700Help
Entry
Rleg2_3700        CDS       T00779                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00860  Porphyrin and chlorophyll metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rleg2_3700
Enzymes [BR:rlt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rleg2_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACI56963
JGI: Rleg23700
UniProt: B5ZTC7
Position
3827874..3828581
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPAHSAEKTAQRLRDMGHEPLLLPLRQPVHDSTAAAAALARTSGAIAVTSAEAV
RVLSALGEQLRPHFARPLFAVGETTAEAARSLGFGSVASSTGNGRDLAELVGAQAADGLL
YLAGTPRAETFEAGLRQRGIGFSVAECYRMQPVVPGQAEIEAIFAGGRPDAVLFYSRQTA
DDFFGVAELRLALREESGIRLLCLSEAVAQAIPAALKKNAAIAPMPDEKSLLSLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtcacccgccccgcgcattcggctgaaaaaaccgcacaacgtctgcgt
gacatgggccacgagccgctgctgctgccgctgcgccagccggtgcacgacagcactgct
gccgcggccgcgcttgcaagaaccagcggcgcgatcgccgtgaccagcgccgaagccgtc
agggtcctctccgctctcggtgagcaactccgtccgcattttgcccgcccgcttttcgcg
gttggtgagacgacggcggaggcagcgcgcagcctcggcttcggttcggtcgcttcatct
accggcaatggccgcgatctggccgagctggtcggcgcccaggcagcggacggcctgctc
taccttgccggcacgccgcgcgcggaaaccttcgaagccggattgcgccaacgcggcatc
ggcttttccgtcgctgaatgttatcgcatgcagcctgtcgtccccggccaggccgagatc
gaagcgatttttgcgggcggtcggccggacgcggttctcttctactcacggcaaacggcc
gacgatttttttggcgtggcggaactccgtttggccctgcgggaggaaagcggaatccgc
cttctctgcctcagcgaggcggtggcgcaagccatcccggcggctttgaaaaaaaatgcg
gcgattgcgccgatgccggatgagaaaagtcttttgtcgctgctttga

DBGET integrated database retrieval system