KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3700Help
Entry
Rleg2_3700        CDS       T00779                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rlt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3827874..3828581
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPAHSAEKTAQRLRDMGHEPLLLPLRQPVHDSTAAAAALARTSGAIAVTSAEAV
RVLSALGEQLRPHFARPLFAVGETTAEAARSLGFGSVASSTGNGRDLAELVGAQAADGLL
YLAGTPRAETFEAGLRQRGIGFSVAECYRMQPVVPGQAEIEAIFAGGRPDAVLFYSRQTA
DDFFGVAELRLALREESGIRLLCLSEAVAQAIPAALKKNAAIAPMPDEKSLLSLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtcacccgccccgcgcattcggctgaaaaaaccgcacaacgtctgcgt
gacatgggccacgagccgctgctgctgccgctgcgccagccggtgcacgacagcactgct
gccgcggccgcgcttgcaagaaccagcggcgcgatcgccgtgaccagcgccgaagccgtc
agggtcctctccgctctcggtgagcaactccgtccgcattttgcccgcccgcttttcgcg
gttggtgagacgacggcggaggcagcgcgcagcctcggcttcggttcggtcgcttcatct
accggcaatggccgcgatctggccgagctggtcggcgcccaggcagcggacggcctgctc
taccttgccggcacgccgcgcgcggaaaccttcgaagccggattgcgccaacgcggcatc
ggcttttccgtcgctgaatgttatcgcatgcagcctgtcgtccccggccaggccgagatc
gaagcgatttttgcgggcggtcggccggacgcggttctcttctactcacggcaaacggcc
gacgatttttttggcgtggcggaactccgtttggccctgcgggaggaaagcggaatccgc
cttctctgcctcagcgaggcggtggcgcaagccatcccggcggctttgaaaaaaaatgcg
gcgattgcgccgatgccggatgagaaaagtcttttgtcgctgctttga

DBGET integrated database retrieval system