KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3731Help
Entry
Rleg2_3731        CDS       T00779                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rleg2_3731
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rleg2_3731
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rleg2_3731
Lipid biosynthesis proteins [BR:rlt01004]
 Fatty acid synthase
  Component type
   Rleg2_3731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3856754..3857398)
Genome map
AA seq 214 aa AA seqDB search
MRFKVAALQFTVIAVSLIFAAAANARTINLVGFGDSLMAGYQLPPGDGFPEKLQAALKAK
GLDVTIANAGVSGDTTTGGLARIDWSIPDGTDGVILELGANDALRGIPPEESEKNLDQMI
ARLKERGIAVLLVGMMAPPNMGADYAERFNPIYRKLSEKHGVPLYGFFLDGVALDAGLKL
DDGMHPNAKGVDVMVGKMEADVTNFVGTISTVKK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaaagttgccgcgcttcaattcaccgtcattgccgtctcgctgatctttgcc
gccgccgccaatgcccggacgatcaacctcgtcggttttggggacagtttgatggcgggc
taccaattgccgcccggcgacggctttccggaaaagctgcaggcggcgttgaaggcgaag
gggctcgacgtcactattgccaatgccggggtctccggcgacacgacgacaggggggctt
gcgcggatcgactggtcgatacccgacggcaccgacggcgtcatcctcgaactcggcgcc
aacgatgcgctgcgcggcattccgcctgaggaaagcgagaagaacctcgatcagatgatt
gcccggctgaaagagcgcggcatcgccgtgctgcttgtcgggatgatggcgccgccgaat
atgggggcggattatgccgaacgtttcaacccgatctaccggaagctttcggaaaaacac
ggggttccgctttatggcttcttcctcgacggcgtggcgctcgatgccgggttaaaactc
gacgacgggatgcatccgaatgcgaagggcgtggatgtcatggtcgggaagatggaagcc
gatgtcacaaatttcgtcggaacgatttctactgtgaagaaatag

DBGET integrated database retrieval system