KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3804Help
Entry
Rleg2_3804        CDS       T00779                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rlt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rlt00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3935245..3936267)
Genome map
AA seq 340 aa AA seqDB search
MSDKLEREVFGQTKAGETVYRVVIRGGGLTAKIISWGAVIQDLRLEGHDAPLQLGFEDFD
SYPLYSAYFGATPGRCANRVGGGAFTLDGKDHQLELNENGVTHLHGGSDNIAKRNWTVVE
HDVDRVVLKIVDPDGRAGYPGNCTIQATFWVHGNGELSVTYESTSDQPTLANVCQHAYFN
LDGREDALGHDIMIAADHYLPTDEKQVPTGEIRSVAGTEFDFREMAPMKRFAGSEQMLYD
HNFCLSGERTAKRSVALARSLYSGVSLEVRSTEPGVQFYAGFKLNTGAPGLGGRKYGPFA
GFCLETQVWPDAINHQGFPNAVLRPGEVLRQETDYIFTKS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataagttagaacgggaagttttcgggcagaccaaggcgggcgagaccgtttat
cgcgtcgtcatcaggggcggcgggctgacggccaagatcattagctggggcgcggtcatc
caggatctgcgcctggaagggcatgacgcgccgctgcagctcggctttgaggattttgac
agctacccgctctattcggcttatttcggcgcgacgcccggccgctgtgccaaccgtgtc
ggcggcggcgcctttacgctcgacggcaaggaccaccagctcgagctgaacgaaaacggc
gtgacgcatctgcatggcggcagcgacaatatcgccaaacgcaactggacggtcgtcgag
cacgatgtcgaccgcgtggtgctgaagatcgtcgatcccgatggccgtgccggctatccc
ggcaattgcaccatccaggcaaccttctgggtgcacggcaacggcgaactgtcggtgacc
tacgaatccacaagcgaccagccgacgctcgccaatgtctgccagcatgcctatttcaat
ctcgatggccgcgaggacgcgctcggccacgacatcatgatcgctgccgaccactatctg
ccgaccgacgagaaacaggtgccgaccggcgagatccgttccgtcgccggcacggaattc
gatttccgcgagatggcgccgatgaagcgtttcgccggcagcgaacagatgctgtacgac
cataatttctgcctgtccggcgaacgtaccgccaagcgtagcgttgcgctcgcccgaagc
ctctattccggtgtgtcgcttgaggtgcgcagcaccgagccgggtgtgcagttctatgcc
ggtttcaagctgaataccggtgctcccggcctcggcgggcgcaaatacggccccttcgcc
ggcttctgcctggagacgcaggtctggccggatgccatcaatcaccagggtttcccgaat
gcggtgctgcgccccggcgaagtgctgcgtcaggaaacggattatatcttcaccaagagc
tga

DBGET integrated database retrieval system