KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3875Help
Entry
Rleg2_3875        CDS       T00779                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg2_3875
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg2_3875
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rleg2_3875
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rleg2_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4016217..4017386
Genome map
AA seq 389 aa AA seqDB search
MTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRGEIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLVLLSDIDGL
YTAPPHLDPNATFLETISEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTSGCAMIIA
SGKTDSPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGGLHVDDGAVTALGAGKSL
LPAGVRSISGLFSRGDTVAIIGPAGREIARGLVSYDAEDARRIAGRKSAEIEAILGYPGR
AAMVHRDDMVMTAQIGSKSERQKKDAAHA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgtaagccgcttggacgctaccgccgcatcgtcatcaagatcggctcggcg
ctgctggtcgaccgcaaggccggcctgaagaaggcctggctcgacgccatgtgcgccgat
atttcaggtttgaaggccaagggcatcgatgtgctcgtcgtgtcctccggcgccatcgcg
ctcggccgctcggtgctcgaccttccctccggcgcgctgaaactggaggaaagccaggcg
gctgccgccgtcggccagatcgcgcttgcgcgcgcctggtcggaaagcctgtcgcgcggc
gagatcgtcgccggccagatcctgctgacgctcggcgacaccgaggagcgccgccgctat
ctcaacgcgcgcgccaccatcaatcagcttctgaaaatcggcgccgtgccgatcatcaac
gagaacgacacggtcgccaccagcgaaatccgctatggcgacaatgatcgcctggccgcc
cgcgttgcgacgatgaccggcgccgacctgctcgtccttctctccgatatcgacgggctc
tacaccgcaccgccgcatctcgacccgaacgcgacattcctggagacgatttccgaaatt
accccggagatcgaagcgatggcagggggcgcggcctccgaactctcgcgcggcggcatg
cgcaccaagatcgatgccggcaagatcgcgacgacatccggctgcgcgatgatcatcgcc
tccggcaagaccgacagcccgctgtcggcgatcgaaaacggcgcgcgttcctcctggttc
gccccgtcgggcacgccggtgactgcccgcaagacctggatcgccggacagctgcagccg
gcgggcggactgcatgtcgatgacggcgccgtcacggccctcggcgccggcaagagcctg
cttcccgccggcgtgcgcagcatttccggcctgttcagccgcggcgatacggtggcgatc
atcggtcccgccggccgcgagatcgcccgtggccttgtcagctatgatgccgaggacgcc
cgccggatcgccggtcgcaagtcggcggagatcgaggccattctcggttatcccggccgc
gccgccatggtccatcgcgacgacatggtgatgaccgcgcagatcggatcgaaatcggaa
aggcagaagaaggacgcggcccatgcttga

DBGET integrated database retrieval system