KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3875Help
Entry
Rleg2_3875        CDS       T00779                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg2_3875
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg2_3875
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rleg2_3875
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rleg2_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4016217..4017386
Genome map
AA seq 389 aa AA seqDB search
MTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRGEIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLVLLSDIDGL
YTAPPHLDPNATFLETISEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTSGCAMIIA
SGKTDSPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGGLHVDDGAVTALGAGKSL
LPAGVRSISGLFSRGDTVAIIGPAGREIARGLVSYDAEDARRIAGRKSAEIEAILGYPGR
AAMVHRDDMVMTAQIGSKSERQKKDAAHA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgtaagccgcttggacgctaccgccgcatcgtcatcaagatcggctcggcg
ctgctggtcgaccgcaaggccggcctgaagaaggcctggctcgacgccatgtgcgccgat
atttcaggtttgaaggccaagggcatcgatgtgctcgtcgtgtcctccggcgccatcgcg
ctcggccgctcggtgctcgaccttccctccggcgcgctgaaactggaggaaagccaggcg
gctgccgccgtcggccagatcgcgcttgcgcgcgcctggtcggaaagcctgtcgcgcggc
gagatcgtcgccggccagatcctgctgacgctcggcgacaccgaggagcgccgccgctat
ctcaacgcgcgcgccaccatcaatcagcttctgaaaatcggcgccgtgccgatcatcaac
gagaacgacacggtcgccaccagcgaaatccgctatggcgacaatgatcgcctggccgcc
cgcgttgcgacgatgaccggcgccgacctgctcgtccttctctccgatatcgacgggctc
tacaccgcaccgccgcatctcgacccgaacgcgacattcctggagacgatttccgaaatt
accccggagatcgaagcgatggcagggggcgcggcctccgaactctcgcgcggcggcatg
cgcaccaagatcgatgccggcaagatcgcgacgacatccggctgcgcgatgatcatcgcc
tccggcaagaccgacagcccgctgtcggcgatcgaaaacggcgcgcgttcctcctggttc
gccccgtcgggcacgccggtgactgcccgcaagacctggatcgccggacagctgcagccg
gcgggcggactgcatgtcgatgacggcgccgtcacggccctcggcgccggcaagagcctg
cttcccgccggcgtgcgcagcatttccggcctgttcagccgcggcgatacggtggcgatc
atcggtcccgccggccgcgagatcgcccgtggccttgtcagctatgatgccgaggacgcc
cgccggatcgccggtcgcaagtcggcggagatcgaggccattctcggttatcccggccgc
gccgccatggtccatcgcgacgacatggtgatgaccgcgcagatcggatcgaaatcggaa
aggcagaagaaggacgcggcccatgcttga

DBGET integrated database retrieval system