KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3954Help
Entry
Rleg2_3954        CDS       T00779                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg2_3954
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg2_3954
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg2_3954
Enzymes [BR:rlt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rleg2_3954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4102276..4103496
Genome map
AA seq 406 aa AA seqDB search
MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNKAKNDPAFQAELKHLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGTEAKEQMLAAEGRLPDLVI
AAVGGGSNAIGIFHPFLDDPTVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLNDTGRVDYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHAIAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaacgcctaaaccgaattccttccgttccgggcctgatgaagacggccgcttc
ggcatctatggcggtcgtttcgttgccgaaacgttgatgcctttgattctcgatctgcag
gacgagtggaacaaggcgaagaacgatccggcattccaggccgaattgaagcatctcggc
gcccattatatcggccgcccgagcccgctctatttcgccgagcggctgacggccgaactc
ggcggcgcgaagatctatttcaagcgcgaggagctgaaccacactggctcgcacaagatc
aacaactgcatcggccagatcctgctcgccaagcgcatgggcaagacccggatcatcgcc
gaaaccggcgccggccagcatggtgttgcctcggctaccgttgccgcccgcttcggcctt
ccctgcgtcgtctatatgggcgccaccgacgtcgagcgtcaggcgccgaacgttttccgc
atgaagctgctcggcgcggaagtgaagccggtgactgccggcagcggcacgctgaaggac
gcgatgaacgaggcgcttcgcgactgggtcaccaatgtcgaagatacctactacctgatc
ggaacggcggccggtccgcatccctatccggagatggtccgcgatttccagtcggtgatc
ggcaccgaagcgaaagagcagatgctggcagccgaaggccgcctgccggatctcgtcatc
gctgccgtcggcggcggttcgaacgcgatcggcatttttcatcctttcctcgatgatccc
accgtgaagattgtcggcgtcgaagcaggcggcaagggcctgcagggcgacgagcattgc
gcctcgatcaccgccggttcgccgggtgtgctgcacggcaaccgcacctatctgctgcag
gatggcgatggccagatcaaggaaggccattcgatttcggccggtctcgattatcccggc
atcggccccgagcattcctggctgaacgataccggccgcgtcgactatgttccgatcatg
gatcacgaagcgctcgaggcgttccagacgctgacccgcctcgaaggcatcatcccggcg
ctcgagccctcgcacgcgattgccgaggtgatcaagcgcgcaccgaagatgggcaaggac
gagatcatcctgatgaacctctccggccgcggcgacaaggatatcttcaccgtcggcaag
attctgggaatgggactgtaa

DBGET integrated database retrieval system