KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3955Help
Entry
Rleg2_3955        CDS       T00779                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg2_3955 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg2_3955 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg2_3955 (trpA)
Enzymes [BR:rlt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rleg2_3955 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4103500..4104339
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTDDATPIVMMGYYNPIYIYGVEKFLDDAI
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPKVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVERIKQHTQLPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTSDGKATADTVQAVATLVRGLSTGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgagggccgtccggcgctt
gtgacctatttcatgggcggcgatcctgattacgatacctcgctcggcatcatgaaggcg
ctgccggaagcaggctccgacatcatcgaactcggcatgcccttttccgatccgatggcc
gacggaccggcgatccagctcgctggtcagcgcgcgctgaaaggcggtcagacgctgaag
aagacgctgcagctggcggccgatttccgcaaaaccgatgacgcgacgccgatcgtgatg
atgggctattacaacccgatctatatttatggcgtcgaaaaattcctcgacgacgcgatt
gctgccggcatcgacggtctgatcgtcgtcgatctgccgcctgagatggatgacgagctc
tgcattccggcgatccgcaaaggcatcaatttcatccgcctggcgacgccgacgacggat
gagaagcgcctgccgaaggttttgaagaacacctccggcttcgtctattatgtctcgatg
aacggcatcaccggttcggcgctgccggatccgtcgctggtttcgggcgcggtcgaacgc
atcaagcagcacacgcaactgcccgtctgcgtcggcttcggcgtcaagacggcggaacat
gcaaaggtcatcggcggttcggccgatggcgtcgtcgtcggcaccgccatcgtcaatcag
gtcgcgaccagcctgacgagtgacggcaaggcgacggcggacacggttcaggccgttgcc
acgctggtgcgcggcctttccacgggaacacgttcggcgcgccttgttgctgccgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system