KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3986Help
Entry
Rleg2_3986        CDS       T00779                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_3986
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg2_3986
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg2_3986
Enzymes [BR:rlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rleg2_3986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4137907..4140078
Genome map
AA seq 723 aa AA seqDB search
MSRIDKNGLAIEAVLHDFLVQEVLPGLAIDADKFFADFSAIVHDLAPKNRALLARRDELE
VKIDDWYRQHGAPADMDDYQSFLRGIGYLLPEGSDFQVSTQNVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPETDGAEKGRGYNPKRGEKVIAWVRDFLDMSVPL
QDSSWKNVGNFTVKDGILVIRSVDGEQAMLVDGGHFAGYRGDAAAPTHILLKNNGIHIKI
VIDATTAIGKTDPAHISDVWLESAITTIMDCEDSIAAVDAEDKTVVYRNWLGLMKGDLQE
EVVKGGTSFVRKLNPDLDYTGPDGTVFELHRRSLMLVRNVGHLMTNPAILDRDGAEVPEG
ILDAVITGLIALYDIGPAGRRKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGMAR
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVARVQQGLKDRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHQVVTEAQIVETMKR
MAAVVDRQNEADPLYQPMAGNFDGSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QAG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgataagaacggtcttgccatcgaagccgtccttcatgatttcctcgtc
caggaggttctgccgggtctggcgatcgatgcggacaagttctttgccgatttttcggcg
atcgtccacgatctcgccccgaagaatcgcgccctgctggcaagacgcgacgagctggag
gtcaagatcgacgactggtatcgccagcacggcgcgccggcggatatggacgactaccaa
tccttcctgcgcgggatcggttatctcctgccggaaggatcggacttccaggtttcgacc
caaaatgtcgaccccgagatcgcctcgatcgccggcccgcagctcgtcgttcccgtcatg
aatgcccgttatgcactcaacgccgccaacgcccgctggggctcgctctatgatgcgctc
tatggcacggacgccattcccgagaccgacggcgcggaaaagggcaggggctacaatccg
aagcgcggcgagaaggttatcgcctgggtacgcgatttcctcgatatgtcggtacctttg
caagacagcagctggaagaatgtcggcaacttcaccgtcaaggatgggatacttgtcatc
agatcggtcgatggcgagcaggccatgcttgtcgatggcgggcattttgccggctatcgc
ggcgatgctgccgccccgacgcatattctcctgaagaacaacggcatccatatcaagatc
gtcatcgatgcgacgacggcgatcggcaagaccgatccggcccatatttccgatgtctgg
ctggaatcggcgatcaccacgatcatggactgtgaggattcgattgccgccgtcgatgcc
gaggacaagactgtcgtttaccgcaactggctcggcctgatgaagggcgacctgcaggaa
gaggtggtaaagggcggaacgagcttcgtccgtaagctcaacccggatctggactatacc
ggtccggatggcaccgtcttcgaactgcatcgccgttcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaacccggcgatcctcgaccgcgacggtgccgaagtgccggagggc
atcctggatgccgtcatcaccggcctgatcgcgctttacgatatcggcccggccggccgg
aggaagaattcccgcaccggttccatgtatgtggtcaagccgaagatgcatggaccggaa
gaggtggccttcgccgtcgagatcttttcgcgggtcgaagatgcgcttggcatggcgcgc
aacaccatcaagatgggcatcatggatgaggagcgccgcacgacggtcaatctcaaggaa
tgcatccgtgctgcccgcgagcgggtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaggccggcccgatgattcgcaagggcgacatgcgc
caggcagcctggatatcggcctatgagaactggaacgtcgacatcggcctggaatgcggc
ctcgccggccacgcccagatcggcaagggcatgtgggcaatgccggatctgatggcggcg
atgctggagcagaagatcgcccatccgaaggccggtgccaacaccgcctgggtcccgtcg
ccgaccgccgcgaccctgcacgccacccattatcaccgggtcaatgtcgccagggttcag
caggggctgaaggaccgcgcccgcgccaagctctccgacattctctccgtgccggtcgcg
gtacggccgaactggacgccggaggaaatccagcgcgagcttgataacaatgcccagggc
atcctcggctacgtcgtacgctgggtcgatcagggcgtcggctgctcgaaggtgcccgat
atcaacaatgtcggcctgatggaggatcgcgccacattgcgcatctcggcccagcacatg
gcgaactggctgcatcaccaggtcgtcaccgaggctcagatcgtcgaaaccatgaagcgc
atggccgccgtcgtcgaccggcagaacgaggcggatcctctctaccagccgatggccggt
aatttcgacggatcgatcgccttccaggccgccctcgacctcgtgctgaagggcagggag
cagccgaacggctataccgagccagtgcttcatcgccgccgcctcgagctgaaggcgaag
caggccggttga

DBGET integrated database retrieval system