KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3986Help
Entry
Rleg2_3986        CDS       T00779                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_3986
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg2_3986
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg2_3986
Enzymes [BR:rlt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rleg2_3986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4137907..4140078
Genome map
AA seq 723 aa AA seqDB search
MSRIDKNGLAIEAVLHDFLVQEVLPGLAIDADKFFADFSAIVHDLAPKNRALLARRDELE
VKIDDWYRQHGAPADMDDYQSFLRGIGYLLPEGSDFQVSTQNVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPETDGAEKGRGYNPKRGEKVIAWVRDFLDMSVPL
QDSSWKNVGNFTVKDGILVIRSVDGEQAMLVDGGHFAGYRGDAAAPTHILLKNNGIHIKI
VIDATTAIGKTDPAHISDVWLESAITTIMDCEDSIAAVDAEDKTVVYRNWLGLMKGDLQE
EVVKGGTSFVRKLNPDLDYTGPDGTVFELHRRSLMLVRNVGHLMTNPAILDRDGAEVPEG
ILDAVITGLIALYDIGPAGRRKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGMAR
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVARVQQGLKDRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHQVVTEAQIVETMKR
MAAVVDRQNEADPLYQPMAGNFDGSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QAG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgataagaacggtcttgccatcgaagccgtccttcatgatttcctcgtc
caggaggttctgccgggtctggcgatcgatgcggacaagttctttgccgatttttcggcg
atcgtccacgatctcgccccgaagaatcgcgccctgctggcaagacgcgacgagctggag
gtcaagatcgacgactggtatcgccagcacggcgcgccggcggatatggacgactaccaa
tccttcctgcgcgggatcggttatctcctgccggaaggatcggacttccaggtttcgacc
caaaatgtcgaccccgagatcgcctcgatcgccggcccgcagctcgtcgttcccgtcatg
aatgcccgttatgcactcaacgccgccaacgcccgctggggctcgctctatgatgcgctc
tatggcacggacgccattcccgagaccgacggcgcggaaaagggcaggggctacaatccg
aagcgcggcgagaaggttatcgcctgggtacgcgatttcctcgatatgtcggtacctttg
caagacagcagctggaagaatgtcggcaacttcaccgtcaaggatgggatacttgtcatc
agatcggtcgatggcgagcaggccatgcttgtcgatggcgggcattttgccggctatcgc
ggcgatgctgccgccccgacgcatattctcctgaagaacaacggcatccatatcaagatc
gtcatcgatgcgacgacggcgatcggcaagaccgatccggcccatatttccgatgtctgg
ctggaatcggcgatcaccacgatcatggactgtgaggattcgattgccgccgtcgatgcc
gaggacaagactgtcgtttaccgcaactggctcggcctgatgaagggcgacctgcaggaa
gaggtggtaaagggcggaacgagcttcgtccgtaagctcaacccggatctggactatacc
ggtccggatggcaccgtcttcgaactgcatcgccgttcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaacccggcgatcctcgaccgcgacggtgccgaagtgccggagggc
atcctggatgccgtcatcaccggcctgatcgcgctttacgatatcggcccggccggccgg
aggaagaattcccgcaccggttccatgtatgtggtcaagccgaagatgcatggaccggaa
gaggtggccttcgccgtcgagatcttttcgcgggtcgaagatgcgcttggcatggcgcgc
aacaccatcaagatgggcatcatggatgaggagcgccgcacgacggtcaatctcaaggaa
tgcatccgtgctgcccgcgagcgggtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaggccggcccgatgattcgcaagggcgacatgcgc
caggcagcctggatatcggcctatgagaactggaacgtcgacatcggcctggaatgcggc
ctcgccggccacgcccagatcggcaagggcatgtgggcaatgccggatctgatggcggcg
atgctggagcagaagatcgcccatccgaaggccggtgccaacaccgcctgggtcccgtcg
ccgaccgccgcgaccctgcacgccacccattatcaccgggtcaatgtcgccagggttcag
caggggctgaaggaccgcgcccgcgccaagctctccgacattctctccgtgccggtcgcg
gtacggccgaactggacgccggaggaaatccagcgcgagcttgataacaatgcccagggc
atcctcggctacgtcgtacgctgggtcgatcagggcgtcggctgctcgaaggtgcccgat
atcaacaatgtcggcctgatggaggatcgcgccacattgcgcatctcggcccagcacatg
gcgaactggctgcatcaccaggtcgtcaccgaggctcagatcgtcgaaaccatgaagcgc
atggccgccgtcgtcgaccggcagaacgaggcggatcctctctaccagccgatggccggt
aatttcgacggatcgatcgccttccaggccgccctcgacctcgtgctgaagggcagggag
cagccgaacggctataccgagccagtgcttcatcgccgccgcctcgagctgaaggcgaag
caggccggttga

DBGET integrated database retrieval system