KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4074Help
Entry
Rleg2_4074        CDS       T00779                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rleg2_4074 (recR)
DNA repair and recombination proteins [BR:rlt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rleg2_4074 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4250852..4251457)
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGPLSNAMGEAYDKVKIC
SRCGNVDTVDPCTVCTDTQRDQSIIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLDGI
GPDDLNIRGLIDRIGEGGIRELIIAVNATVEGQTTAHYITDQLQGLNVKITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgagtcaccggccccgaaatcgaaaaactcatccagcttctggcgaaggtg
ccgggcctcgggccgcgctcggctcgccgggcggcactgcatctgatcaagaagaaagac
cagttgctggggcccctgtcgaatgcgatgggcgaggcctacgacaaggtgaagatctgt
tcgcgctgcggcaatgtcgataccgtcgatccctgcaccgtctgcaccgacacgcagcgc
gatcaatccatcatcatcgtcgtcgaggacgtatcggacctctgggcgctggagcgggca
ggcgcgatgaacgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacgggatc
gggcccgacgatctcaatattcgcgggctgatcgaccggatcggcgaaggcggcatccgg
gagctgatcatcgcggtcaacgccaccgtcgagggccagacgacggcgcattacatcacc
gaccagctgcaggggcttaacgtgaagatcacccggctggcgcatggcgtgccggtcggt
ggcgagctcgactatctcgacgaaggcacgcttgccgcagcacttcgggcacggacggtg
atatga

DBGET integrated database retrieval system