KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4085Help
Entry
Rleg2_4085        CDS       T00779                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rleg2_4085
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rleg2_4085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4259532..4260098
Genome map
AA seq 188 aa AA seqDB search
MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAEEAPAAGGEAAPAAAA
VPIAQLLASADAKAGETVFKKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFGYSAAM
KDFSKGSSEKWTFEFLNKFLMAPKKDVPGTAMGFAGLAKDQDRANVILYLHTLADSPVPL
PDPKTATQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatacgtcaatacggccgtgggggcactgctcggaacgattttcgttctgatg
tcggtctctatcgcgtccgaagggatcttccattccgaagcaccggaaaaggaaggtttc
gcgatcgttgccgaagaggcgcccgccgctggtggcgaagctgcgcctgccgctgctgcc
gttcccatcgcgcaattgctcgcttctgccgatgccaaggccggtgaaacggtcttcaag
aagtgtcaggcctgtcatgacggcaccaaagggggaccgaacaaggtcggtcccaacctc
tttggtgtcgtagatcgcccgatcgcctcgcatgagggctttggctattccgccgccatg
aaggatttctccaagggcagcagcgagaagtggaccttcgaattcctcaacaaattcctg
atggcgccgaagaaggacgttcccggcactgccatgggctttgccggtctggcgaaagat
caggaccgcgccaacgtcatcctctacctgcacacgctcgccgattcgccggtgccgctg
ccggacccgaagaccgcgacgcagtga

DBGET integrated database retrieval system