KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4129Help
Entry
Rleg2_4129        CDS       T00779                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_4129 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_4129 (glk)
   00052 Galactose metabolism
    Rleg2_4129 (glk)
   00500 Starch and sucrose metabolism
    Rleg2_4129 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg2_4129 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rleg2_4129 (glk)
   00524 Butirosin and neomycin biosynthesis
    Rleg2_4129 (glk)
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rleg2_4129 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4309195..4310220)
Genome map
AA seq 341 aa AA seqDB search
MPKPNHSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQQGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLGMEDVLVVNDFEAQALAVA
ALSDENRERIGEATGDMIASRVVLGPGTGLGVGGLVHAQHSWIPVPGEGGHVDLGPRSKR
DYQIFPHIETIEGRVSAEQILCGRGLVNLYHAICVVDGIQPTMKDPADITSHALAGSDKA
AVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKILPALRRPEFRLAFEDKAPHTA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaccgaaccacagcaccgctccgctgcctttcccgatcctgatcggcgatatc
ggcggcacgaatgcccgcttctccatcctgaccgacgcctatgccgagccgaagcagttt
ccgaacgtgcgcacggcggatttcgccacgatcgacgaggcgatccagcaaggggtgctc
gacaagaccgccgtgcagccgcgttcggcgatccttgccgtcgccggcccgatcaacgac
gacgagatcccgctgaccaattgcgactgggtggtgcggccaaagacgatgatcgaaggc
ctcggcatggaggacgtgctggtcgtcaacgatttcgaggcgcaggcgctcgcagtcgcc
gctctttcggatgagaaccgcgaacgcatcggcgaggccaccggcgacatgatcgcgtcg
cgcgtcgtgcttggacccggcaccgggctcggcgtcggcgggctggtgcatgcccagcac
agctggatcccggttcccggcgaaggcggccatgtcgatctcggaccgcgcagcaaacgc
gactatcaaatcttcccgcatatcgagacgatcgaagggcgcgtgtcggccgagcagatc
ctttgcgggcgcggcctcgtcaacctctaccatgccatctgcgtggtcgacggcatccag
ccgaccatgaaggatcccgccgacatcacctcgcacgcgcttgccggcagcgacaaggcg
gcggtcgagaccgtctcgctgtttgccacctatctcggccgggtggcgggcgacatggcg
atggtgttcatggcgcgcggcggcgtttatctctcaggcggcatctcgcagaagatcctg
ccggcgctgaggaggccggaattccgcttggccttcgaggacaaggcgccgcatacagca
ctgcttcgcaccatcccgacctatgtggtgacgcatccgctggcagcgcttgccgggctt
tcctcatatgcccgcatgccggcgaatttcggcgtctcgacggaaggccgccgctggcgg
cgctga

DBGET integrated database retrieval system