KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4177Help
Entry
Rleg2_4177        CDS       T00779                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rlt00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4352599..4353906
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRRKRDGDELDPADIRSFIAALAAGQLSEGQIGAFAMAVWFKGMSREEIVALTL
AMADSGDRLQWTDIDRPIADKHSTGGVGDNVSLMLAPIAAACGLAVPMISGRGLGHTGGT
LDKLESIPGYRITPDADLFHTVVKQVGCAIIGQTGALAPADGRLYAVRDVTATVDSIPLI
TASILSKKLAAGLQTLVLDVKVGNGAFMADRAQAEILAQSLVEVANGAGVKTSALITDMN
QPLADAAGNAVEMRNCLDFLAGGKADTRLEAVVLAFAAEMLVKSGIAASSEEGEGMARRA
LSSGKAAEVFARMVSMLGGPADLMENPDRYLARAAVEKPVLAARSGWLAACDARGIGVSV
IDLGGGRRHPADRIDHRVGFSELLPLGSRVSAGEPIALVHAADDAAAERAAAALAAHYRI
TEDSPKLTPVISSRI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcaggagatcatccggcgcaaacgcgatggcgacgaactcgaccccgccgat
atccggtctttcatcgcagccctcgcggccggccagctgtcggaaggccagatcggcgcc
ttcgccatggccgtctggttcaagggcatgtcacgcgaggaaatcgttgctctgacgctg
gcgatggccgattccggcgatcggctgcaatggacggatatcgaccgcccgatcgccgac
aaacattcgaccggcggtgtcggcgacaatgtttcgctgatgctggcgccgattgctgcc
gcctgcggcctcgccgttccgatgatatcggggcgcggcctcggtcataccggcggcacg
ctcgataagctcgaatccattcccggctataggatcaccccggatgccgacctgttccac
acagtcgtgaagcaggtgggatgcgccattatcggtcagaccggcgccctggcgccggcc
gatgggaggctctatgccgtgcgcgatgtgaccgcaaccgtcgattccattccgctcatc
accgcctccatcctgtcgaagaaacttgcggccgggcttcagacgctggtgctcgacgtc
aaggtcggcaacggcgccttcatggccgaccgtgcccaggcggagatcctggcgcagtcg
ctggtcgaggttgccaatggggcaggggtgaagacctcggcgctgatcaccgacatgaac
cagccgctcgccgatgcggccggcaatgccgttgaaatgcgcaattgcctggatttcctg
gcgggtgggaaggcggacacgcggctcgaggctgtcgttcttgcctttgccgccgagatg
ctggtgaagtcgggtattgccgcgtcctctgaagaaggcgaggggatggcgcgtcgagcg
ctgtcatcgggaaaggcagctgaggttttcgcgcgcatggtatccatgcttggcggcccg
gccgatctcatggaaaaccccgacaggtatctcgccagggcggctgtggaaaaacctgtc
cttgccgcccggtcaggctggcttgccgcatgcgacgcgcgcggcatcggcgtcagcgtc
atcgatcttggcggcggcagacgccatccagctgaccggatcgatcaccgcgtcggcttc
tcagaattgctgccgcttggcagccgggtcagtgcgggcgagccgatcgcgctggttcat
gccgccgacgacgcggccgcggaaagggcagcggccgcccttgccgcgcactaccgtatc
accgaagacagtccgaagctgacgccggtgatttcgagccggatctga

DBGET integrated database retrieval system