KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4209Help
Entry
Rleg2_4209        CDS       T00779                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg2_4209
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rleg2_4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4386426..4387475)
Genome map
AA seq 349 aa AA seqDB search
MRTRRHLTALLLAAALVPSPTLAADPPCYRGVNLSGGEYGERDGIYGTNYNYPSEETIRY
FAEKGMTIVRLPFRWERLQPALGGRLDEDELKRIKDTVGLIRKHGMAVLLDPHNFGYYDK
VQVGTAPATDAAFGDFWARLAVEFANQDGVLFGLMNEPHDIKATDWLEAANAAIRSIRAV
GARNLILVPGTAWSGAHSWEEDVIGGANGTVMLGVRDPLDFYAYEVHQYLDIDSSGTHPT
CEGATGAVEAIAGVTAWLKKNHKRGFLGEFGAAADKDCMSGLTEIYSTMSDNGDAWLGWS
YWAAGEWWPADEPFNVQPRKGAERPQMRLLVNSAKAKAGACASVKPAGK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgagacgacatctgacggcgctgctgcttgcggccgctctcgtcccctcgccg
acccttgcggccgacccgccctgctatcgcggcgtcaatctttccggcggcgaatatggt
gagcgcgacggcatttacggcacgaattataactatcccagcgaagagacgatccgctat
ttcgccgaaaagggcatgacgatcgtccggctgcccttccgctgggagcggttgcagccg
gcgctgggcggccggctcgacgaggacgaactcaagcggatcaaggataccgtcgggctg
atccgcaagcacggcatggccgtgctgctcgacccgcataatttcggctattacgacaag
gtgcaggtcggcacggcgccggcgacggatgccgccttcggtgatttctgggcaaggctt
gcggtcgaattcgccaatcaggacggcgtgctcttcggcctgatgaacgagccgcacgat
atcaaggcaacggactggctcgaggccgccaatgcggcgatccgcagcatccgcgccgtc
ggcgcccgcaacctcatcctggtgccgggcacggcctggagcggcgctcacagctgggag
gaggatgtgatcggcggcgccaacggcacggtgatgctcggcgtgcgcgatccgctcgac
ttctacgcctatgaggtccaccagtatctcgacattgattcctccggaacccatccgacc
tgcgagggtgctaccggcgctgtcgaagcgatcgccggcgtcaccgcctggctgaagaag
aaccacaagcgcggctttctcggcgagttcggcgccgctgccgacaaggactgcatgagc
gggctgaccgagatctattccaccatgtccgataatggcgacgcctggctcggctggtcc
tattgggccgcaggcgaatggtggccggccgacgagccgttcaacgtccagccgcgaaag
ggcgctgagcggccgcagatgcggcttctcgtcaattcggcaaaagccaaagccggcgcc
tgcgccagcgtcaagccagcggggaagtga

DBGET integrated database retrieval system