KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4368Help
Entry
Rleg2_4368        CDS       T00779                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Rleg2_4368
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Rleg2_4368
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Rleg2_4368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4535561..4536466
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETVKRGLAPAMEGARVAKLELRRGDLRFPFPDAFADRVSGRTIVSLGRRAKYL
LVDLDDGNTLISHLGMSGSFRIEEGRIEEGAGAATPGEFHHARSKDEKHDHVVFHLESPA
GPRRVVYNDPRRFGFMDMVGRADLAAHPFFRDLGPEPTGNELGAAYLAERFRHKAQPLKS
ALLDQKNIAGLGNIYVCEALWRAHLSPIRAAGTLATAGGRPKEQLNLLVASIRDVIADAI
TAGGSSLRDHIQTDGSLGYFQHSFSVYDREGQACRTPGCGGTVARIVQAGRSTFYCATCQ
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccagaagtcgaaacggtaaaacgcggcctggcgccggcgatggagggt
gctcgtgtcgccaagcttgagctgcgccgcggcgatctgcgctttccctttcccgacgct
ttcgccgacagggtttccggtcgcaccatcgtcagccttggccgtcgcgccaaatatctg
ctggtcgatctcgacgacggcaacacgctgatttcccatctcggcatgtccggctctttt
cgcatcgaggagggtcgcatcgaggagggcgctggagcggccacgcctggcgaattccac
catgcccgctcgaaggacgagaagcacgaccacgtcgtctttcatctggaaagtccagcc
ggtccgcgccgtgtcgtttataacgatccgcgccgtttcggcttcatggatatggtgggg
cgcgccgaccttgccgcccatcccttcttccgtgatctcggcccggagccgacgggaaac
gagctcggcgccgcctatctcgccgagcgcttccgccacaaggcgcagccgttgaagagt
gcgctgctcgaccagaagaacattgccggtctcggcaatatatatgtctgcgaggcgctg
tggcgcgcccacctttcgccgatccgcgccgccggcacgctggcaaccgcaggcggccgg
ccgaaagagcagcttaacctgctcgtggcctcgatccgcgatgtcattgccgatgcgatc
accgccggcggatcgtcgctgcgcgaccatatccagaccgacggatcgctcggctatttc
cagcattccttctccgtctatgatcgcgaaggtcaggcttgccgcacgcccggctgcggc
ggtacggtcgcccgcatcgtccaggcgggccgctccaccttctattgcgccacctgccag
aagtaa

DBGET integrated database retrieval system