KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4487Help
Entry
Rleg2_4487        CDS       T00779                                 

Definition
formaldehyde dehydrogenase, glutathione-independent
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_4487
  Energy metabolism
   00680 Methane metabolism
    Rleg2_4487
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rleg2_4487
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Rleg2_4487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:complement(120092..121282)
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLVLGHEITGEIIEKGVDVEMLDIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPARA
GGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIRDLTMLSDILPTGFHGAV
RAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKDRLAHAARVGFEPIDLSKS
DRLGDMIAQVVGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKQGNLSLRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHDRLPIADIVN
AKVIPLDEAAAGYESFDHGAATKFVLDPHGDVAKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaatagaggcgtcgtttatctccggccgggcaaggtcgaagttcgcgacatc
gacgacccgaagctggaagcgcccgacggccgccgcatcgagcacggcgtcatcctgaag
gtgatctccaccaatatctgcggctccgaccagcacatggtccgcggccgtacgacggca
atgccaggcttggtgctcggtcatgaaatcaccggcgagatcatcgagaaaggcgtcgac
gtcgagatgctcgatatcggcgatatcgtctcggtcccgttcaatgtcgcctgcggccgt
tgccgctgctgcaagtcccaggataccggcgtctgcctgacggtcaatccggcccgcgcc
ggcggcgcttacggttatgtcgacatgggcggctggatcggcggacaggcgcgctacgtc
accattccctatgccgatttcaacctgctcaaaatccccgatcgggacaaggcaatggcg
aagatccgcgatctcaccatgctctccgatattctgcccaccggcttccatggcgcggtg
cgcgcaggcgttggggtcggatcgaccgtctacgtcgcaggcgccggccctgtcggcctt
gcggctgccgcatcggcgcgcatcctcggcgccgctgtcgtcatgatcggcgacttcaac
aaggatcgcctggcacatgcggcaagggtcggtttcgaaccgatcgacctctccaagagc
gaccgcctcggcgacatgatcgcccaggtcgtcggcagcaatgaagtggacagcgccatc
gacgcggtcggcttcgaagcgcgcggccattcgggcggcgaacagccggcgatcgtgctc
aatcagatgatggagatcacccgcgccgcaggctcgatcggtattcccggcctctacgtc
accgaggatccgggcgccgtcgacaatgccgccaaacaaggcaatctgtcgctccgcttc
ggcctcggctgggccaaggcgcagtctttccacaccggccagacgccggtgctcaagtac
aatcggcagctcatgcaggcgatcctgcacgaccggctgccgattgccgacatcgtcaat
gccaaggtcattccgctcgacgaggccgccgccggatatgagagcttcgaccacggagcg
gcgacgaaattcgtcctcgatccgcatggggacgtcgcgaaagccgcctag

DBGET integrated database retrieval system