KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4643Help
Entry
Rleg2_4643        CDS       T00779                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg2_4643
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Rleg2_4643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:276892..277947
Genome map
AA seq 351 aa AA seqDB search
MVWDKMRLEQLRAEFADTNGGEIFDETFRKVAEKIISKNGTRLAPYSGVPTFLSAPYMQV
AAEEPDFGNLQVAITGIPMDLGVTNRPGSRFGPRALRAIERIGPYNHVLATAPVFDLRVA
DIGDVSFQSRYRLELSHDDIERRIGQIVDAGIAPLSVGGDHSISHPILKAIGRQQPVGLI
HIDAHCDTSGAFDRTKFHHGGPFRNAVLDGALDPTRTIQIGIRGSAEYLWEFSYASGMTV
IHAEEISGMGIAAIVAKAKSIVGDGPTYISFDVDSLDPSFAPGTGTPEVGGLTTREVLEL
IRGLKGINLVGGDVVEVAPQYDATSNTAHAAAQVLFEILSLMVFSPSIGGR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgggacaaaatgcggcttgaacagctgcgcgcggaatttgcggacaccaatggc
ggcgagatattcgatgagacgtttcgcaaagtggcggagaagatcatctccaaaaacggc
acgcgactggcgccatattctggagtgccaactttcctcagcgcaccctatatgcaggtc
gctgccgaagagccggacttcggcaatctccaggtcgcaatcaccggaatcccgatggat
ctcggtgtcaccaaccgtccgggttctcgtttcggaccgcgcgctcttcgcgccatcgaa
aggatcggcccgtacaatcacgttctcgccaccgccccggtctttgatcttcgggtcgcc
gacatcggcgacgtttcgttccagagccgttaccggctggagctcagccacgacgacatc
gaaaggcgcattggccaaatcgttgatgccggcattgccccgctttccgtcggaggcgat
cattcgatcagccatccgattttgaaggccatcggccggcaacaaccagtcggtcttatc
catatcgatgcccattgcgacacaagcggcgcatttgatcggacaaagtttcatcatggc
ggaccgttccggaacgctgtgctggacggcgcactcgacccgacaagaacaatccagatc
ggcatccgtggttcggccgaatatttgtgggaattctcctatgcgtcgggaatgaccgtg
atccatgccgaggagatcagcggaatggggattgcggcgatcgtcgccaaggcaaaatcc
atcgtcggcgacggcccaacatatatttccttcgacgtcgacagcctggatccgagcttt
gcacccggcaccggcacacccgaggtcggcggattgaccacgcgtgaggttcttgaattg
atccgcggcttgaaaggcataaacctcgtgggcggcgacgtcgtcgaagttgcgccgcaa
tatgacgcaacgagcaacactgctcacgccgcagcgcaggtactcttcgagatcttgagc
ctgatggtgttcagcccatcgatcggcggacggtga

DBGET integrated database retrieval system