KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4651Help
Entry
Rleg2_4651        CDS       T00779                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_4651 (tpiA)
   01230 Biosynthesis of amino acids
    Rleg2_4651 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_4651 (tpiA)
   00051 Fructose and mannose metabolism
    Rleg2_4651 (tpiA)
   00562 Inositol phosphate metabolism
    Rleg2_4651 (tpiA)
Enzymes [BR:rlt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rleg2_4651 (tpiA)
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rleg2_4651 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rleg2_4651 (tpiA)
  Exosomal proteins of melanoma cells
   Rleg2_4651 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:287488..288252
Genome map
AA seq 254 aa AA seqDB search
MVVWVGTSFKMNKTVEEALAFAHRLAATDAERDTRVQRFVIPAFTAVREVKRLLAETSVK
VGAQNMHWEDAGAWTGEISPLMLKDCQLDIVELGHSERREHFGETDETVGLKVSAAIRHG
LTPLICIGETLHEREEGRADAVLRRQVEAALRGVETEADKAPILLAYEPVWAIGAKGIPA
TADYASERHGKIAEVVKSILGRAVPVLYGGSVNPENCQELITEAHIDGLFIGRSAWGVDG
YLDILRRVSAAIER
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtctgggtcggcaccagcttcaagatgaacaagacggtggaggaagcgctggct
ttcgcgcaccgcctcgcagcgacggatgcggaacgcgatacccgcgtgcagcgcttcgtc
attccggcttttaccgcggtgcgcgaggtcaagcgtctgctggccgagacttcggtgaag
gtcggcgcccagaacatgcactgggaggatgccggcgcctggaccggcgagatttctcct
ctgatgctgaaggactgccagctcgacatcgtcgagctcggccattccgagcggcgcgag
catttcggcgagaccgacgaaaccgtcggcctcaaggtttccgccgccatccgccatggc
ttgacgccgctgatctgcatcggcgagaccttgcatgagcgcgaggagggccgggccgat
gctgttttgcggcgccaggtcgaggcggctctgcgcggcgtcgaaaccgaggccgacaag
gctccgatcctgcttgcctatgagcctgtctgggcgatcggcgccaagggaataccggcg
accgccgactacgcgtcggagcggcacggcaagatcgccgaggtggtgaaatccattctt
ggccgtgcggtgccggttctctacggcggcagcgtcaatccggaaaattgtcaggaactg
atcaccgaggcgcatatcgacggcctgttcatcggccgctccgcctggggcgtcgacggt
tacctcgacattcttcgccgcgtcagcgcggcgatcgaaaggtga

DBGET integrated database retrieval system