KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4651Help
Entry
Rleg2_4651        CDS       T00779                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Rleg2_4651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG201:287488..288252
Genome map
AA seq 254 aa AA seqDB search
MVVWVGTSFKMNKTVEEALAFAHRLAATDAERDTRVQRFVIPAFTAVREVKRLLAETSVK
VGAQNMHWEDAGAWTGEISPLMLKDCQLDIVELGHSERREHFGETDETVGLKVSAAIRHG
LTPLICIGETLHEREEGRADAVLRRQVEAALRGVETEADKAPILLAYEPVWAIGAKGIPA
TADYASERHGKIAEVVKSILGRAVPVLYGGSVNPENCQELITEAHIDGLFIGRSAWGVDG
YLDILRRVSAAIER
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtctgggtcggcaccagcttcaagatgaacaagacggtggaggaagcgctggct
ttcgcgcaccgcctcgcagcgacggatgcggaacgcgatacccgcgtgcagcgcttcgtc
attccggcttttaccgcggtgcgcgaggtcaagcgtctgctggccgagacttcggtgaag
gtcggcgcccagaacatgcactgggaggatgccggcgcctggaccggcgagatttctcct
ctgatgctgaaggactgccagctcgacatcgtcgagctcggccattccgagcggcgcgag
catttcggcgagaccgacgaaaccgtcggcctcaaggtttccgccgccatccgccatggc
ttgacgccgctgatctgcatcggcgagaccttgcatgagcgcgaggagggccgggccgat
gctgttttgcggcgccaggtcgaggcggctctgcgcggcgtcgaaaccgaggccgacaag
gctccgatcctgcttgcctatgagcctgtctgggcgatcggcgccaagggaataccggcg
accgccgactacgcgtcggagcggcacggcaagatcgccgaggtggtgaaatccattctt
ggccgtgcggtgccggttctctacggcggcagcgtcaatccggaaaattgtcaggaactg
atcaccgaggcgcatatcgacggcctgttcatcggccgctccgcctggggcgtcgacggt
tacctcgacattcttcgccgcgtcagcgcggcgatcgaaaggtga

DBGET integrated database retrieval system