KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4685Help
Entry
Rleg2_4685        CDS       T00779                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rleg2_4685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:324426..325412
Genome map
AA seq 328 aa AA seqDB search
MRLLIAASLFALAAVQPGTAADLSAYKRPLTVPFEGVTAYSPQLATLGKMLFFDPRLSGN
KNMTCASCHNPSFGFETPVKTPIGAANTALGRQAPTVLNVAWVSPFFWDGRAPNLEQQAA
GPITAPAEMNGKLDDAVTEMQDIPDYKNWFGEVFPDKGISKETLLTAIATYERTVVSNWS
PFDRWVDGDEKAVSDSAKRGFELFTGTAGCSACHSGWNFSDNRFHDIGLPSDDIGRYKID
PSSPGNKYAFKTPGLRNTLYRGPYMHDGSLKSMDEVITHYESGGVSRPSLDPDMSAFLLT
DQERSDLIAFLGTLTAEKQDIPLPTLPN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcctgattgcagcttccctcttcgcattggccgcagtccagcccggcacggcc
gccgatctttccgcctataaacggccgctgaccgtgcctttcgagggcgtaacggcctat
tcccctcaactggcgacgctcggcaaaatgctgttcttcgatcccaggctttccggcaat
aagaatatgacctgcgccagctgtcataacccctccttcggcttcgagacgcctgtgaag
acgccgatcggcgcggccaataccgcgctcgggcgccaggcgccgacggttctgaacgtt
gcctgggtttcgcctttcttctgggacggccgcgcgccgaacctggagcagcaggcggcg
ggcccgatcaccgctcccgccgaaatgaacggcaagctcgacgacgccgtcaccgaaatg
caggatatacccgattacaaaaactggttcggcgaggtcttcccggacaagggcatcagc
aaggagacattgctgacggcgatcgctacctatgagcggacggtggtttccaactggtcg
cccttcgaccgctgggtggatggcgacgagaaggcggtttccgacagcgccaagcggggc
ttcgagctgtttaccggcacggccggctgttccgcctgccattcgggctggaatttctcc
gacaacaggttccatgacatcggcctgccgagcgacgatatcggccgctacaagatcgat
ccgagcagccccggcaataaatatgccttcaagacgcccggcctgcgcaacacgctctat
cgtggtccctatatgcatgacggcagcctgaagagcatggacgaggtgatcacccattat
gaaagcggcggcgtcagccgtccatcgctcgatcccgacatgtcggcctttctgctgacg
gaccaggagcgcagcgatctgatcgcctttctcggaaccttgaccgccgagaagcaggac
atcccccttccgacgctgccgaactga

DBGET integrated database retrieval system