KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_4755Help
Entry
Rleg2_4755        CDS       T00779                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00052  Galactose metabolism
rlt00561  Glycerolipid metabolism
rlt00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rleg2_4755
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rleg2_4755
   00600 Sphingolipid metabolism
    Rleg2_4755
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rleg2_4755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ACI58000
JGI: Rleg24755
UniProt: B6A066
Position
pRLG201:386954..388270
Genome map
AA seq 438 aa AA seqDB search
MPKICLIGAGSTVFAQNILGDVLSTPSDHDYIIGLFDIDPERLKTSEIVARRICASLKLD
TVRIEATLNRREALKGADFVILMMQVGGYKPATVTDFNVAKNYGLRQTIADTLGIGGIFR
GLRTIPVLESICGDMEEVCPNALLMQYVNPMAINCWAIKEIAPSIRTVGLCHSVQHTADH
LARCLGEKIDNISYISAGINHIAFFLKYEKLHGDGSREDLYPKLKALAAEGKVPADDRVR
FDALKRLGHFVTESSEHFAEYTSWYIKNHQPELVDQLNIPLDEYIRRCELQISQWHVLRQ
DLEGGRPIEVCRSNEYASGIIHAAVTGKPALIYGNVPNNGLIENLPPECIVEVPCHVDRN
GVQPTRIGRIPSQLAAVMRLSISVQELTVEAALTGKRDRIYQAALLDPHTSAELSPDKIW
HMVDDLIEAHGDLLPNYH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaatttgccttatcggggctgggagtaccgtcttcgcccagaacattctggga
gatgtgctgtccacgccctcagaccatgactacatcatcggcctttttgacatcgatcca
gagcgcctcaaaacatccgagatcgtcgcgcggcgcatatgcgcgtcgctgaagctcgac
acggttcggatcgaggcaacgctcaaccgccgggaggcgctgaaaggtgccgatttcgtg
atcctgatgatgcaggttggcggctataaaccggcaacggtcacggatttcaacgtggcg
aagaactacggcttgcgccagaccattgcggatacgcttggcatcggcggcatcttccgc
ggtctcaggacgatcccagtcctcgaaagcatctgcggcgacatggaagaggtgtgcccg
aatgcattgctaatgcagtatgtaaacccgatggcgattaattgctgggcgatcaaggaa
atcgccccgagcattcgcaccgtcggtctctgccacagtgttcaacatacggcagatcac
cttgccaggtgcctcggcgagaaaatcgacaatatcagttacatctcagccggcatcaac
catatcgctttcttccttaaatatgaaaagctccatggcgatggcagccgcgaagacctt
tatcccaagctgaaggcgctggccgcggagggcaaggttcccgcagatgaccgtgttcgc
tttgatgccctgaaaaggctcggtcatttcgtgaccgaatccagcgagcattttgcggaa
tatacgtcatggtacatcaagaaccaccaaccggaattggtagaccagctcaacattcca
ctcgacgaatatattcgccgttgcgagctgcagatctcacaatggcatgtcctgcggcag
gacctcgaagggggaagaccgatcgaagtatgccgcagcaatgaatatgcttcaggcatt
attcatgctgcggtgaccgggaagccggcgctgatttatggaaatgtgccgaacaacggc
ctgattgaaaatcttccgccagaatgcattgtcgaagttccatgccatgtcgatcgcaat
ggcgtccaaccgacgcggatcggtaggatcccttctcaattggccgccgtcatgcggctg
agcatttccgtgcaggagctcactgtcgaagcggcactgacaggcaagcgtgaccgcatc
tatcaggccgcgctgctcgatccgcacacctcggcggaactttcgcctgataaaatctgg
catatggtcgatgacctcatcgaggcacatggcgatctgctgccgaactaccactga

DBGET integrated database retrieval system