KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5007Help
Entry
Rleg2_5007        CDS       T00779                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00340  Histidine metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rleg2_5007
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rleg2_5007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh CHASE3
Motif
Other DBs
NCBI-ProteinID: ACI58231
JGI: Rleg25007
UniProt: B6A0U7
Position
pRLG201:654177..655523
Genome map
AA seq 448 aa AA seqDB search
MSDTLVSIHTLSALDDAQRKALLQRTESDLSAFIDKVNPIIEAVRIDGDAALADFARQFD
KAQVAADQLRATTEEFSAARASIDPELITTLEFAAGNIRHFHEKQMPETLVLHETHRGVL
VGDRWNAIDSVACYVPRGKGSFPSSVLMTAIPAKVAGVRKVVIITPPGPDGTVDPATLVA
AEIAGVSDVFKCGGAQAIAAVAFGTQTVPKCDKVVGPGSPWVVAAKKQLSSLIDPGSPAG
PSELIIFSDGSVPAELVALDLCVESEHGPDSSVFFVTDNADFANAVASCVPALWSRMGNI
RAQYSKTVLSGPRGGIVIARTRADALAFVNDYAPEHLAVLADNAWQYLACFEHAGEILLG
PHSAISVANFVLGPSHVLPTGGAAKTTSPLSVFDFLKRTSIASLSKEAYGGFAAHAERLA
RYEGFDGHANAVSTIRDEALRSAAGAST
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacactctcgtttcgatacacacgctcagcgccttggacgacgcccagcgcaaa
gccctattacaacgaaccgaaagcgatctgagcgctttcatcgataaggtaaatccgatc
attgaagccgtccgcattgatggcgacgcagcccttgcggatttcgcccgccaatttgac
aaagcgcaggtcgcggccgaccagcttcgcgcgaccaccgaggagttctccgcggcgcgc
gccagcattgatccagagctcatcaccactcttgaattcgctgctggaaacatccgccac
ttccacgaaaagcagatgccggagacgcttgttttgcacgagacgcatcggggcgtcctc
gtaggcgaccgatggaacgcgatcgactccgtcgcctgctacgttccccgcggcaaaggc
tcatttcccagttcggtgctgatgacagccattccggcaaaggtggctggcgtcagaaag
gttgttatcatcaccccgcccggccccgacggcaccgtcgatccggcgacgcttgtcgca
gcagagatcgctggggtctcagacgtcttcaagtgcggtggtgcgcaagccatcgcggcc
gtcgccttcgggactcaaacggttccaaaatgtgacaaggtcgtcggtccgggcagccca
tgggtggttgcggcaaagaagcagctgtcatccttgatcgatccgggaagccccgcaggt
ccgagcgaacttatcatcttttccgatggttcggtgcccgccgagctggtggcgctggat
ctctgcgtagagtcggagcacggtccggactcttccgtcttcttcgtaaccgacaatgcg
gacttcgcaaatgcggtcgcttcctgtgtcccagccctctggtcacgaatgggtaacatc
cgggcgcaatattccaagactgtgctttccggtccaaggggagggatcgtcattgcccgt
acccgggcggacgctctcgccttcgttaacgactacgctccggaacacctcgcagtcctc
gccgataatgcctggcaatatctcgcctgctttgagcatgcaggcgaaatccttctcggc
ccgcattccgcaatcagcgttgccaacttcgtgctcggacccagtcacgttctgcccaca
ggaggagccgccaaaacgacctctccattgtcggtcttcgactttctgaagcgcacttcg
atcgcttcgctgtctaaagaggcctatgggggctttgccgctcatgccgaacggctcgct
cggtacgagggcttcgacggtcatgccaacgctgtttcgacgatccgtgacgaagcgctt
cgctctgccgccggcgccagcacctaa

DBGET integrated database retrieval system