KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5237Help
Entry
Rleg2_5237        CDS       T00779                                 

Definition
MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rleg2_5237
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rleg2_5237
Enzymes [BR:rlt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Rleg2_5237
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rleg2_5237
Two-component system [BR:rlt02022]
 CheA family
  CheA-CheYBV
   Rleg2_5237
Bacterial motility proteins [BR:rlt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rleg2_5237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:867199..871173
Genome map
AA seq 1324 aa AA seqDB search
MAYEEQEYMEQGAGAAQPGRHVQPLVIVGIAVSEQSLSSLEQIFSEVDVGLSASYLVAVH
QQKGLSTATVLGLLGRQNRLSVTVAADGARLLQNQIYISGSDDVVTLEDGHIRVRPASEP
VGHRGTVDTMLISLAEHAGERAIVVVLLGLENDGTAAVAATKNFGGLSIVEIGENANTSF
EDGRGAVAIADLRLPAQSIASQIALHASNVNENEDAGIGDETPSALEAQITQIATVLRNI
TSHDFHGYKRGTFSRRVHRRMQVLQIVSIDAYIERLRASRDEVQDLFQDLLIGVTQFFRD
PAEFEALEREIPKLFEGKGASDKFRVWVLGCATGEEAYSIAMLLREHVSTMDYPPEVQIF
ATDLDARALGIARAGRYSAAITSHVPPERLARWFVREGDTYCVVKELREMCIFSPHNIVK
DAPFSRIDILSCRNLLIYLDNELQNRVMPIFHFALRPSGILFLGSSENVTRHAKLFASVD
RKNRLFRRLETATRIIPDFPLSPRPRSPDHPFSPPAPMLQTGRLSATISRQAEVVAERFA
PAYVVVDSHYDVLHFSGRTGRYLEPTSGTATLNLLSLAHRDLRLDMRSALQRATAEAVKV
EVPRVLLHQDDRSYAVNIIVEPLGSGDVTSLIVLFQDAGQVAEGTALDGGRLTSEEHVQR
LETDLRLTRDRLQATIEELESTNEELKSSNEEYQSINEELQSANEEMETSKEELQSVNEE
LQTVNGELAHRVAELDRANSDLKNLLEATQIATVFLDNDLRVRSFTPAATEIFHLLETDV
GRPLDHVVSRVAYPQLLDDVRLVLRTLMPVDRKVSDPTDNRHYAARALPYRSVDNYIGGA
VVTFTDLTATYEAEMALRRSEERLQRVLETDAVGVVFLNKDGVIVDANEVFLKMSGYSRS
QMGRPELHWRRLTPSEHIAETEAQMEALTETGRMGPYEKEYLLADGARRWMLFAGRDLGD
GTIAEFCIDISARKQAQAALRQEEEQFRLFGEASSDVLWIRDAETLEWNYLAPAFEAIYG
VERQQALRDNNFRNWVELIIPEDREKALSEIRRVRNGERAEYEYRIRRASDHEIRWLRNA
EFPLFREEGTFTQIGGIGRDITDEKVSADRMKILVGELQHRTRNLMAVVRSMADKTLRTS
TDLADFHKKFRDRLDVMARVQGFLSRLQDGGRITFDQLIRSELSSHGVAEGETSRVFLQG
PDGVRLRSTTVQTMALAIHELATNAIKYGALCQPQAHLAIVWRVEKQGENAKPWLHVDWR
ESRVKMPPAGSGPQGGGQGRELIERALPYQLDAKTSYALGEDGVHCTIAIPVSLSNLIEV
DGHG
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaggaacaggagtacatggagcaaggggcgggggcggcgcaaccgggtcgc
cacgtacagccgctcgtgatcgtcggcatcgcggtctcagagcagtccctgagctcgctc
gaacagatattttcagaagtcgacgtaggattgagcgcatcctatcttgtggcagtacac
cagcagaagggccttagcaccgcaaccgtacttggattgctcgggcggcagaacaggctt
tcagtgaccgtcgcagccgacggtgcgcggctcctccagaaccaaatctatatcagtgga
tcggacgatgtcgtcacgctcgaggacggtcatatccgcgtccgtccggcctccgaaccg
gtcggccaccgcgggaccgtcgacaccatgctgatttctttagcagagcatgcaggtgag
cgggcgatcgttgttgtcctgctggggctcgaaaatgacggcaccgctgcggttgcggca
accaagaacttcggcggcctgtcgatcgtggagattggcgaaaacgcaaatacctctttc
gaggatgggagaggggcggtggcgattgcggatctgcgtctaccggcccagagcattgca
tcccaaattgcccttcacgcgagcaatgtcaacgagaatgaagacgctggaataggcgat
gaaaccccaagcgcgctcgaggcgcagatcacccagatagccacggttctccgcaacatc
acgagtcacgactttcacggatacaaacgcgggacattcagccgacgcgtccacagacgc
atgcaggtgctgcagattgtcagcatcgatgcatatatcgagcgattgcgcgccagccga
gacgaagttcaagacctgtttcaagacctgctgatcggtgtcacccagttttttcgagac
ccggccgagtttgaagcgctcgagcgcgaaattccaaaactgttcgaaggaaagggggcg
agtgacaaattccgcgtctgggtgctgggttgcgcgaccggagaagaagcctattcgatc
gcaatgctgctgcgcgagcacgtatccaccatggattatcctccggaagtgcagatattt
gcgacggatctcgacgcacgcgcactgggaattgcgcgcgctggccgctattcggctgca
atcacttcccatgtgccgcccgagcggctcgcccgctggttcgtacgagaaggcgacacc
tattgcgtggtcaaggaattgcgggagatgtgtatcttctcaccgcataacatcgtcaag
gatgcaccattttcccgcattgacatcctgtcgtgcagaaacctgctgatctatctcgac
aatgaattgcaaaacagggttatgccgatcttccactttgctctccggccaagcggcatc
ctgtttttgggatcgtcggaaaatgtaacccgccacgcaaagctttttgcctctgtcgac
cgcaaaaaccgcctgtttcggaggctcgaaacggcaacccggatcattccggacttccca
ctcagcccccgtccgcgcagccccgaccatccgttctcgccaccagcgcccatgctccag
accggccggctatcggccacgatcagccggcaggcggaggtcgtagcagagcgctttgct
ccagcctatgtggttgtcgattcgcactatgatgttctccacttctcaggacgcacgggc
cgctatctcgaaccgacgtcaggaacggcgaccctcaacctgctgagccttgcccatcgc
gatcttcggctcgatatgcgctccgccttgcagcgtgccacggcggaagccgtcaaggtg
gaagtgccgcgggtgctgttgcaccaggacgatcgcagctatgccgtcaatatcatcgtc
gaacctcttggcagcggcgacgtcacctcactgatcgtgctttttcaagacgcaggccag
gttgccgaggggacggcgctggacggaggacggctgacgagcgaagagcacgtccaacgt
ctcgagaccgatctgcgcctgacgcgtgatcggctccaggcgaccatcgaggagctcgaa
tccacgaacgaagagctcaaatcgtccaatgaagaataccagtcgatcaatgaagagctg
cagtcggccaacgaggaaatggaaacctccaaggaagaactgcagtctgtcaatgaggag
ctgcagaccgtcaacggcgaacttgctcaccgcgtcgcagaactggaccgggcaaattcc
gacttgaagaacctgctcgaggcgacccagatcgccactgtgttcctcgacaacgatctg
cgggtcagaagctttacgccggcggcaaccgaaatattccacctgcttgagaccgacgtc
ggccgaccgctcgaccacgtcgtatcgcgggtggcttatccgcaactgttggatgatgtc
cggcttgttctgagaacgctgatgcccgtggaccggaaggtcagcgaccccacggacaac
cggcactatgcggcgcgtgcactgccgtatcgcagcgtcgacaattatatcggcggagct
gtcgtcaccttcacagacctgacggcgacctacgaggcggagatggcgcttcgacgcagc
gaagaacgcctgcagcgcgttttggagacagatgcggtcggggtggtctttctgaacaag
gacggcgtcatcgtcgacgccaacgaagtgttcttgaagatgtccgggtatagtcgctcc
caaatgggtcgcccggagcttcattggcgccggctgaccccgtcggagcatattgccgag
accgaagcacagatggaagctttgacagagactggccgcatgggcccctacgaaaaggag
tatctcctcgccgatggcgcccgtcgctggatgttgtttgccggacgcgatcttggcgac
ggaacgatcgcggagttctgcatcgacatctccgcacgaaaacaggcacaggcagctttg
cgccaggaggaggagcagttccgcctgtttggcgaagcctcgtccgacgttttgtggatc
cgcgacgcggagacgcttgaatggaattacctcgcgccagccttcgaggccatctatggt
gtggaacggcagcaggcccttagggataataattttcgcaactgggtggaattgatcatt
cctgaagatcgagagaaggcgctctccgaaatccgtcgcgtgcgaaatggcgagcgcgcg
gaatacgagtaccgcatcaggcgagcgtctgaccacgaaatccgttggttgcgtaacgcc
gaattcccgcttttccgagaggaaggaacgtttacgcagatcggcggtatcggccgcgat
atcaccgatgaaaaggtctctgccgatcgtatgaaaatcctcgtcggcgaacttcagcat
cgcacgcgcaacctcatggccgtcgtccgttcaatggccgacaagaccctgcggaccagc
acagatctggccgatttccacaaaaagtttcgcgaccggctggatgtgatggcgcgggtg
cagggcttcttgtcgcggctgcaggatgggggtcgcatcactttcgaccagcttatccgc
tccgaactgtcttcccacggcgtagcggagggcgagacgagccgggttttcttgcaaggt
ccagacggagtcaggcttcgatcaacgaccgtccagacgatggcgcttgcgatacacgag
cttgccaccaatgcaatcaagtacggggcgctttgccagcctcaggcgcatctggcgatc
gtttggcgcgtcgaaaaacaaggcgaaaacgccaagccatggctgcacgtcgattggcgg
gagagccgggtgaagatgccgcctgccggttctggaccacaagggggcggccagggccgc
gaactgatcgagcgcgcgctgccctatcagctcgatgcgaagacgtcctatgcccttggt
gaggatggggtccattgcacgatcgcaatccctgtttctctcagcaacctgatcgaggtt
gatggtcatggttga

DBGET integrated database retrieval system