KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5384Help
Entry
Rleg2_5384        CDS       T00779                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00500  Starch and sucrose metabolism
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
Module
rlt_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg2_5384
Enzymes [BR:rlt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rleg2_5384
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rleg2_5384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACI58564
JGI: Rleg25384
UniProt: B6A1T0
Position
pRLG201:1019584..1021797
Genome map
AA seq 737 aa AA seqDB search
MNVERSELLAGIGHDALWALIDGRHGDPFSILGPHESGGMTIVRVYLPGAEAVDLIEAAS
GRVVTPFSIAHPAGLFAAATGLRSGYRLKITWPDAVQITEDPYSFGLLLGELDLHLISEG
THYSLSRTLGAVAMSIDGISGVRFAVWAPNARRVSVVGDFNAWDGRRNPMRLRQSAGVWE
LFIPSLAPGERYKFEIIDAEGTCLPQKADPVARASEAAPSTASIVASSTPFRWTDDGWMK
GRSRQARLEGAISVYEVHAGSWLRDGRDGNRYLDWVELSQRLVPYASDMGFTHIELLPIM
EHPFGGSWGYQPLGLFAPTGRYGTPEDFAYFVDRCHGAGLGVILDWVPAHFPTDVWGLAR
FDGSALYEHEDPREGFHRDWNTLIYNLGRNEVKGFLIASALEWLERYHVDGLRVDAVASM
LYRDYSRNEGEWIPNQYGGRENLEAVEFFKHLNSIVHQRCPHAMTIAEESTAWPGVTKPP
EEGGLGFDIKWNMGWMHDSLSYIEKDPVYRSHHHGTMTFGMIYAYSERFMLPISHDEVVY
GKGSLLTKMPGDEWQKFANLRSYLAFMWGHPGKKLLFMGSEIAQPGEWNHDASVSWDVLD
RPQHVGIQRLVKDLNSLYGDEPALQFGDFHPQGFEWAAADDAANSVLGMLRYSEDRSSSV
LVVSNFTPVPRYGYRIGVPDDGVWIERITTDAREYGGSGLVNGALSSEPIPVHGRPVSLS
LTLPPLATVFLKSPSPG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgagcgctcggaacttctggccggcatcgggcacgatgccctctgggccctg
atcgatgggcgccacggcgatcctttttcgatcctcggtccccatgaaagcggcgggatg
acgatcgtgcgggtctacctgcccggggcggaggcggtcgatctcatcgaggccgcgagc
ggacgggtggtgacgcccttcagcatcgcccatcccgccggcctgtttgcggcggcaacc
ggtttgaggagcggataccggctgaagatcacctggccggatgcggtgcagatcaccgag
gatccctatagtttcggtctcctgctcggtgaactcgacctccacctgatatcggagggc
acgcattacagtctgagccgcacgcttggcgcagtggcgatgtcgatcgacggcatatca
ggcgttcgtttcgccgtatgggcgccgaatgctcgccgcgtctcggtcgtcggtgacttc
aatgcctgggacgggcggcgaaatccgatgcggctgaggcaatcggcgggcgtctgggag
ctgttcattccgagcctcgcccccggcgaaagatacaagttcgagatcatcgatgctgag
gggacatgcctgccgcaaaaggccgatccggtggcgagggcgagcgaggccgccccatcc
accgcctccatcgtcgcatcgtcgacgccgtttcgatggaccgatgacggctggatgaaa
ggccggtcccggcaagcgagactggagggcgcgatctcagtttacgaggtgcacgccggc
tcctggctgcgcgacgggcgggacggcaacagatatctcgactgggtcgagctcagccag
cggctcgttccctatgccagcgacatggggtttacccatatcgagttgctgccgatcatg
gagcacccgttcggcgggtcctggggctatcagccgctcggcctgtttgccccgaccggg
cggtacgggacgcccgaggatttcgcttattttgtcgaccgctgccatggcgccgggctc
ggcgtcatcctcgactgggtgccggctcacttccccacggatgtctggggtctagcgcgc
ttcgacggcagcgcactctatgaacacgaggatccgcgcgagggctttcaccgcgactgg
aatacgctgatctacaatctcggtcgcaacgaggtgaaaggcttcctgatcgccagcgcg
ctcgaatggctggagcgttatcatgtcgacggcttgcgcgtcgatgccgtggcctcgatg
ctctaccgcgactacagccgcaatgaaggcgaatggattcccaaccaatatggcggccgc
gagaacctggaggcggttgagttcttcaagcacctgaacagcatcgtccaccagcgctgc
ccgcatgcaatgaccatcgccgaggaatcgacggcctggccgggtgtgacgaagccgccg
gaagaaggcgggctgggcttcgacatcaaatggaacatgggctggatgcatgacagcctg
agttacatcgagaaggatccggtctatcggagccatcatcatggcacgatgaccttcggc
atgatctacgcctattccgagcgcttcatgctgccgatttctcatgacgaggtggtctat
ggcaaaggctcgctgctgaccaagatgccgggcgacgaatggcagaagtttgccaatctg
cgcagctatctcgctttcatgtggggtcatcccggcaagaagctgttgttcatggggagc
gaaatcgcccagccgggcgaatggaaccacgatgcttcggtgagctgggatgtgctggac
cggcctcagcatgtcggcattcagcggctggtcaaggatctgaatagtctctacggggac
gagccggcattgcagttcggcgattttcatccccagggcttcgaatgggcggcggccgac
gatgccgccaattccgttctcggcatgctccgttattccgaggaccgctcttcatccgtc
cttgtcgtatcgaatttcacgccggtgccgcgctacggctataggatcggcgtgcccgat
gacggcgtgtggatcgagcggatcaccacggatgcacgcgaatatggcggctccggcctc
gtcaacggcgcgctgtcgagcgaacccatccccgtgcatggccggccggtttccctgtcg
ctgacgctgccgccgctggcgacggtctttctcaagagcccgtcgcctggatag

DBGET integrated database retrieval system