KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5398Help
Entry
Rleg2_5398        CDS       T00779                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg2_5398
Enzymes [BR:rlt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rleg2_5398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:1039800..1041692
Genome map
AA seq 630 aa AA seqDB search
MMKSAELDKLARRHGISLTRPSPENREVVISAATKRKILSALNIELTEDQEPGEPRRKAK
PDGRKIPVSFLPDFLSDTRVWGVSLQLYELRSARNWGIGDFQDLADLADLAGSLGADFIG
LNPLHAPFLADPDRCSPYEPSSRQHLNPLYIAVDQVPGFAGNPKLEQELERLRQSDLVDY
IGVARAKLGALRDLWSARRQCRVGDEADFDAFVAQGGDSLRLHALFECLSAFMVERGAGA
GWQRWPAELQRFDSAAVGDFEREHADDVRFHMWLQWLAHRQLMQAADRARKAGLRIGLYL
DLAVGEAVDGSATWSEPDIYVSQATIGSPPDPFAVDGQDWHLAGYLPSEIAGGEMSPYRR
MVGTAMRYAGAIRIDHAPAIRRLFLVPLGSRPDGGAYVRYPEDRLLQILAEVSAEHRCLV
IGESLGMIPEGLQEDLATAGILSYRILSYEQDEKGFKPADAYPVLALACISTHDHQTLAG
WWRGADIQDRCEHGIVPPDLTEEHLKYRKRERRYLKAVFNAAGLDVPPRLTAARASQEAL
QDLTVSAYRFIARTPSLLTSVRLADLTDEKAPTNIPGTSDSYPNWKPKLSVLLEDLLSVL
LLKRVTAAMREERPRYASATRMEIDRGRNE
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatccgcagagctcgacaaactcgcccgccgccacggcatcagcctgacaagg
cctagccccgagaaccgggaagtggtgatctcagccgcgactaagcgcaaaatactctcg
gcattgaatattgaactgacggaggatcaagagcctggtgagccgcggcggaaggctaag
ccggatggcaggaagatcccggtgtcgtttctgccggatttcctatccgacacacgggtc
tggggcgtgagcttgcagctttacgagctccgttcggcacgcaactggggcataggagac
ttccaggatctcgccgatttggccgatctggcgggatcgctgggggcggatttcatcggt
ctcaatccgcttcacgcgccgttcctcgccgatcctgatcgctgcagcccctatgaaccc
tcaagccgccagcatctcaacccgctctatatcgcggtcgaccaggtgccgggctttgct
ggcaatcccaagctggaacaggaattggagcgccttcgccaatccgatctcgtcgactac
atcggtgtcgcgcgggccaagcttggagcccttcgtgatctctggtcggcgcggcgacaa
tgccgtgttggcgacgaggccgatttcgacgcatttgtcgcgcaaggcggcgacagcctg
cggctgcatgcgctgttcgaatgcctctccgctttcatggtcgagcgcggggcgggcgcc
ggctggcagcggtggccggccgagttgcagcgcttcgacagcgccgctgtcggcgatttc
gaacgcgagcatgcagatgacgttcgctttcacatgtggctgcaatggctcgcccaccgc
cagctgatgcaggcggcagatcgggcgcgcaaggccggcctcaggatagggctctatctc
gatcttgccgtcggggaggcggtcgacggctcggcgacatggagcgagccggatatctat
gtctcgcaggcgacgatcggtagtcctccggatccattcgccgtcgatgggcaggattgg
caccttgccggatacctgccatccgaaattgccggaggggagatgtcgccttaccggcgc
atggttggcaccgccatgcgctacgcgggcgccattcgtattgatcacgcaccggcgatc
cgccgccttttcctggttccgttaggcagcaggccggatggcggcgcctacgtccgctat
cccgaggaccggctgttgcagatcctcgccgaggtttccgctgaacatcgatgccttgtc
atcggggagtccctcggaatgattcctgaaggcttgcaagaggatctggctactgccggc
attctctcctaccggatcctttcctatgaacaggatgagaagggcttcaagcccgccgat
gcctatccggtcctcgcgctcgcctgcatttcgacgcatgaccaccagacgcttgccggc
tggtggcgcggcgccgacattcaggatcgctgtgaacacggtatcgtgccgcccgatctc
accgaagaacatctcaaataccgcaagcgcgagcggaggtatctgaaagcggtcttcaac
gccgctggcctcgacgtgccgccccggctcacggcggcgcgggcaagccaggaagcgttg
caagatctgacggtgagcgcttatcgtttcattgctcgcacgccgtcgttgctgacatcg
gtgcggcttgccgatctcaccgacgagaaagcgccgaccaatattccgggcaccagcgac
agctatccgaactggaagccgaagctttcggttttgctggaggatctgctgtcggtcctg
ctgctcaagcgcgtaacggcggcgatgcgggaggaaaggccgcgctacgcctccgcgacg
cgaatggaaatcgatcggggacggaacgaatag

DBGET integrated database retrieval system