KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5489Help
Entry
Rleg2_5489        CDS       T00779                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_5489
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_5489
   00052 Galactose metabolism
    Rleg2_5489
   00500 Starch and sucrose metabolism
    Rleg2_5489
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg2_5489
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rleg2_5489
   00524 Butirosin and neomycin biosynthesis
    Rleg2_5489
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rleg2_5489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG201:1137138..1138103
Genome map
AA seq 321 aa AA seqDB search
MQQVAIGIDLGGTQVRAALVDEHGRILTRLAEPTDALAGPDRVLAQICGLADRLLAASKP
ASVVGVGVSAPGPLDTVTGVATDIPTLPGFVDFPLKAELQKRFAFPVDLENDAIAAAVGE
WQFGIGKGLDNLVYVTVSTGIGGGVISDGRVVRGRKGMAAHVGHMSVVPNGELCPCGNRG
CFEAYGSGPAFARRAQMRAMESRDTTLGSNGGAIDSRSVFAAARNGDRLANQLVDEEAEI
LGRGFTNLIHIFSPDIIVMGGGLSHEFDRLQPGIQAYISQWAMPAFKDVKVVLAALDQNS
GLVGAAALAFLAGKVAPTDHL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggttgccattggcatagacctcggcggaacgcaggtgcgcgccgcccttgtc
gacgagcacggcaggatcctgacgcgtttggccgaaccgacagatgcgctggccggcccc
gaccgggtgctcgcccagatttgcggcctcgccgatcggctgctcgcagcatcaaagcct
gcttcggtggtgggcgtcggcgtatccgccccaggcccgctcgatacggtcaccggtgtc
gcaaccgatatccccacccttccgggcttcgtcgattttccgctgaaggcggagttgcag
aagcgatttgcctttccggtcgatctcgaaaacgacgccattgccgcggcggtcggcgag
tggcagttcggtatcggcaaggggcttgataacctcgtctatgtcacggtcagcaccggt
atcggcggcggcgttatctcggatggtcgcgtggtgcgcggccgcaagggcatggcagcc
catgtcggccacatgtcggtggtgccgaacggcgagctttgcccttgcggcaacaggggc
tgtttcgaggcctatggatccggaccggcttttgcgcggcgcgcgcaaatgcgggcgatg
gaaagccgcgacacgacgctcggcagcaatggcggcgccatcgacagccgcagcgttttc
gcggcggctcgaaatggcgatcgtctcgcaaatcaactggtcgatgaggaagcggagatt
ctcggccgcggcttcaccaacctgatccatatcttcagtcccgatatcatcgtcatgggg
ggagggctctcccacgaattcgaccgtctgcaaccgggtatccaagcctatatcagccag
tgggcgatgccggcattcaaggatgtgaaggtggtgctggcggcattggatcagaactcg
ggccttgtcggcgcggcggctctggcctttctggcggggaaggtcgctccgaccgatcat
ctttag

DBGET integrated database retrieval system