KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5489Help
Entry
Rleg2_5489        CDS       T00779                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00010  Glycolysis / Gluconeogenesis
rlt00052  Galactose metabolism
rlt00500  Starch and sucrose metabolism
rlt00520  Amino sugar and nucleotide sugar metabolism
rlt00521  Streptomycin biosynthesis
rlt01100  Metabolic pathways
rlt01110  Biosynthesis of secondary metabolites
rlt01120  Microbial metabolism in diverse environments
rlt01130  Biosynthesis of antibiotics
rlt01200  Carbon metabolism
Module
rlt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rlt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg2_5489
   00052 Galactose metabolism
    Rleg2_5489
   00500 Starch and sucrose metabolism
    Rleg2_5489
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg2_5489
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rleg2_5489
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rleg2_5489
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rleg2_5489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N EF_assoc_1
Motif
Other DBs
NCBI-ProteinID: ACI58667
JGI: Rleg25489
UniProt: B6A233
Position
pRLG201:1137138..1138103
Genome map
AA seq 321 aa AA seqDB search
MQQVAIGIDLGGTQVRAALVDEHGRILTRLAEPTDALAGPDRVLAQICGLADRLLAASKP
ASVVGVGVSAPGPLDTVTGVATDIPTLPGFVDFPLKAELQKRFAFPVDLENDAIAAAVGE
WQFGIGKGLDNLVYVTVSTGIGGGVISDGRVVRGRKGMAAHVGHMSVVPNGELCPCGNRG
CFEAYGSGPAFARRAQMRAMESRDTTLGSNGGAIDSRSVFAAARNGDRLANQLVDEEAEI
LGRGFTNLIHIFSPDIIVMGGGLSHEFDRLQPGIQAYISQWAMPAFKDVKVVLAALDQNS
GLVGAAALAFLAGKVAPTDHL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggttgccattggcatagacctcggcggaacgcaggtgcgcgccgcccttgtc
gacgagcacggcaggatcctgacgcgtttggccgaaccgacagatgcgctggccggcccc
gaccgggtgctcgcccagatttgcggcctcgccgatcggctgctcgcagcatcaaagcct
gcttcggtggtgggcgtcggcgtatccgccccaggcccgctcgatacggtcaccggtgtc
gcaaccgatatccccacccttccgggcttcgtcgattttccgctgaaggcggagttgcag
aagcgatttgcctttccggtcgatctcgaaaacgacgccattgccgcggcggtcggcgag
tggcagttcggtatcggcaaggggcttgataacctcgtctatgtcacggtcagcaccggt
atcggcggcggcgttatctcggatggtcgcgtggtgcgcggccgcaagggcatggcagcc
catgtcggccacatgtcggtggtgccgaacggcgagctttgcccttgcggcaacaggggc
tgtttcgaggcctatggatccggaccggcttttgcgcggcgcgcgcaaatgcgggcgatg
gaaagccgcgacacgacgctcggcagcaatggcggcgccatcgacagccgcagcgttttc
gcggcggctcgaaatggcgatcgtctcgcaaatcaactggtcgatgaggaagcggagatt
ctcggccgcggcttcaccaacctgatccatatcttcagtcccgatatcatcgtcatgggg
ggagggctctcccacgaattcgaccgtctgcaaccgggtatccaagcctatatcagccag
tgggcgatgccggcattcaaggatgtgaaggtggtgctggcggcattggatcagaactcg
ggccttgtcggcgcggcggctctggcctttctggcggggaaggtcgctccgaccgatcat
ctttag

DBGET integrated database retrieval system