KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5699Help
Entry
Rleg2_5699        CDS       T00779                                 

Definition
(GenBank) Amidase
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:98713..99873
Genome map
AA seq 386 aa AA seqDB search
MQDRWNAFMPYPDADVGHAPIGSLFGLRLAVKDLFDVAGYPTAAGNAAVLVASGIKRATA
PLVQTLLEAGACFVGKTNTDELAYSLIGGNIHFGMPINPRDPTLIPGGSSSGSAVAVAAG
LADLGLGTDTSGSIRLPAAINGLIGWRPTHGSLDNRALRPLAPSFDVPGFMTRSLESMAA
VMSAVGMPAANDRPISILIPEDIFETIDGTIADEMIASIRSAAMPIRRIDFISSFSLADL
AVAFTTILQKEAWESNKTLFERSPDAIAPDIAARLRAGSRLDDGEMREARRIRTLFSGEI
ERLLCENMVIALPTLAMNPPTRDAGPESFAAFRSACIKLLCLAGLSGCPQLAFPIASRVG
NASLSLFGARSTDSLLMNVARRIGAE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaccggtggaatgccttcatgccctatccggatgcggatgtcggtcacgcgccc
atcggttcgctcttcggccttcgcctggcggtaaaggaccttttcgacgttgccggctat
ccaactgcggccggcaacgcggcggtgctcgtcgcctccggaatcaagagggcgacggcg
cctttggtccagacgctcctggaggccggcgcctgttttgtcggcaaaaccaatacggat
gagctcgcctattcgctgattggcggcaacatccattttggcatgcctatcaatccacgc
gaccccaccctcatccccggcggatcgtcgtccggttcagccgtcgcggttgccgccggc
cttgcggacctcgggcttggaacggacacgtccggctccatccggctgcccgccgccatc
aacggcctcatcggctggcggccgacacatggaagcctcgacaacagggcactgcgtccg
ctggcgccaagcttcgacgtgccgggtttcatgacgagaagcctggaatccatggccgcg
gtgatgagcgccgtcggcatgcccgcggcaaatgaccgaccaatatccattctcattccc
gaagatatcttcgaaaccatcgatggtacaatcgccgatgagatgatcgccagcatccga
tcggcggccatgcctattcgcaggatcgactttatttcctcattcagcctcgcggatctt
gctgtggcattcaccaccatcctgcaaaaggaagcctgggaaagcaataaaacgctcttt
gagcggagtcctgacgccattgctcccgatatcgccgcgcgccttcgcgcaggatctcgc
ctggacgacggggagatgcgcgaggcgcgcagaatccgcacgctcttttccggggagatc
gagcgacttctctgcgaaaatatggtcatcgctcttccgaccctggccatgaacccgcca
acgcgcgatgccgggccggaaagcttcgccgcatttcgatccgcctgcatcaagcttctg
tgtctcgcaggcctgagcggctgcccgcaactggcttttccaatcgccagtcgcgtgggg
aacgcttcgctgtccttgttcggcgcacgcagcactgacagtctgctcatgaatgtggcc
cggcgaataggagccgagtga

DBGET integrated database retrieval system