KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5701Help
Entry
Rleg2_5701        CDS       T00779                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09936  
bacterial/archaeal transporter family-2 protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5701
Transporters [BR:rlt02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Rleg2_5701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(100320..100757)
Genome map
AA seq 145 aa AA seqDB search
MTVFILIACLGGVLVGLSRQLNGRLSISTTPLIASFWNHAVGFIVLTCLGLVVGGLLPAG
AAEAPWYIYLGGPIGVVFVAAGSWAIARIGAVNTALLIIGGQMVTGVAMDYARAAPTSFW
ANATGIVLIVGGMMVSRRRRKSGGS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgttcattctcattgcctgcctcggcggcgtgctcgtcggcctcagccgtcag
ctcaatgggcggttgagcatatcgaccacgccgctcatcgcatccttctggaaccatgcc
gtaggctttattgtgctgacctgccttggtctcgttgtcggaggcctgctaccggccggc
gccgccgaggcgccttggtatatctatctgggtggtccgatcggcgtcgttttcgtggcg
gcaggcagctgggcgattgcgcgcatcggcgcggtcaatacggctctgctgatcattggc
ggccagatggtcaccggtgtggcgatggattatgcgcgcgccgctccgacgtcgttctgg
gcgaacgcgacgggaattgttctcatcgtcggcggaatgatggtcagccggaggcgacgc
aaaagcggcggctcgtaa

DBGET integrated database retrieval system