KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5704Help
Entry
Rleg2_5704        CDS       T00779                                 

Definition
(GenBank) TrkA-C domain protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(101722..103488)
Genome map
AA seq 588 aa AA seqDB search
MRVDQWLSLLIIALMMGAFVWGRYRYDVVAVSSLLVAVIAGIVPAKSAFSGFSDDIVIIV
GSALIVSAAISRSGIMDLALRRFSPERRGPRMQLIILVAIVAALSAFVKNIGALAIMIPV
AVQMARKSRVSPSMFLMPMSFASLLGGLMTQIGTSPNIIVSRVREEITGQPFTMFDYTPV
GLALSVAGVVFLGLFYKLLPERSRVETSMDEAVAIKNYTTEAKVIMPSGAIGRSVSWLQK
PAGGDAMVTAIIGGGGQRRTPLPDTVLKDGDLLIIEGEQSALDKIVSEAKLQLSDRKHEA
ETRQDISSVEAIVGEHSRLIGVSAKDVALFHNTGLNLLAVSRRDRRFTERLGEIKIRNGD
VVVLQGDLQKLPDLLREWGCLPLVARDLKLGNARNGMIPVMILLATMGATAFGGIPVATA
FFAAAFLMVVTGSVPLREVYHHLDAPILIMLAALIPISDSLRTTGTTEIIADLLSRTAEM
LPPFGALTLILVAAMAVTPFLNNAATVLVMAPIAATFAAKLGFRPDAFLMAVAIGAGCDF
LTPIGHQCNTLVMGPGGYRFGDYARLGLPLSLIVVLVSVPALLAVWPI
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttgaccaatggctctctcttctcatcatcgcgctgatgatgggcgccttcgtc
tgggggcgttatcgatacgacgtcgtcgccgtgagttcgcttctcgtcgccgtcattgcc
ggcatcgtccctgccaaaagcgccttttcgggtttttcagatgacattgtcatcatcgtc
ggcagtgcgctgatcgtcagtgcggcgatatcgagatcagggatcatggatctggcgttg
cgccgattttctcccgaaagacgcgggccgcggatgcagctgatcatcctggtagccatc
gtcgcagccctgtcggctttcgtcaaaaacatcggtgcgctggcgatcatgatcccggtt
gccgtgcagatggcccggaaatcacgggtgtcaccgtcgatgttcctgatgccgatgtct
ttcgcctcgctgctcggagggcttatgacgcagatcggcacatcgccgaatatcatcgtt
tcccgggtgcgggaggagatcaccgggcagccgtttacgatgttcgactatacgcctgtc
ggcttggcgctctcggtcgccggcgttgtctttctcgggctgttctacaagctgctgcct
gaaagatcgcgggtggaaacgtcgatggacgaggcggtggcgatcaagaactatacgacc
gaggccaaggtcatcatgccgtcgggggcgattggccggtccgtcagctggctgcagaag
ccggccggcggcgatgccatggtgaccgcgattatcggcggcggcggccaaagacgaacg
ccccttcccgacaccgtgctcaaggatggcgaccttctgatcatcgagggcgagcagagc
gcactcgataagatcgtcagtgaagccaagcttcaactgtccgatcgtaaacacgaggcc
gagacgcgccaggacatcagttccgtcgaagccatcgtcggcgaacattcccgcctgatt
ggcgtcagcgcaaaagacgtcgctctcttccacaataccggcctcaatcttcttgccgtc
agccgccgggacaggcgcttcaccgagcgtctgggcgagatcaagatccgcaacggcgac
gtcgtggtcttgcagggcgacttgcagaagctgccggatcttttacgcgaatggggatgt
ttgccgctggtcgcacgcgatctgaagctcggcaatgcccgcaacggcatgatccccgtc
atgatcctgctggcgacgatgggggcgacggccttcggcggcattcccgtggcgacggca
ttttttgccgccgcctttctgatggtggtgaccggatccgttcccctgcgcgaagtctat
catcatctcgatgcgcccattctgatcatgctggccgctctcattccgatcagcgattcg
ctcagaaccaccggaaccaccgaaatcatcgctgatctgctgtcgcggaccgccgaaatg
ctgccgccattcggcgccctgacgctcatcctggttgcggccatggcggtgacgccgttc
ttgaacaacgcggcgaccgttctggtcatggcgccgatcgccgcgacctttgccgccaag
ctgggctttcggcccgatgcgtttctgatggcggtggccatcggcgccggctgtgatttc
ctcacgccgatcggccaccaatgcaacacgctggtcatgggcccaggcggatatcgattt
ggcgattatgcccgattgggcctgccactctcgctcattgtcgtgctcgtcagtgtgcct
gccctgctggcagtctggccgatctga

DBGET integrated database retrieval system