KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5708Help
Entry
Rleg2_5708        CDS       T00779                                 

Definition
(GenBank) ABC transporter related
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rleg2_5708
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     Rleg2_5708
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Rleg2_5708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:108601..109389
Genome map
AA seq 262 aa AA seqDB search
MVSDPPKLRITEASQSYDGRRWQFRGLDLDLKSGEITVILGPNGRGKSTLLRVLAGVLKP
TSGELQLNPCTGFVPQEFSGSFPYTVLDTVLMGRARHVGLFRTPSKIDIDKAMDALNATG
MSGFASRNIDALSGGERQLVLIARALAGENEVLLLDEPASALDLKNQDKVLALIGDLADR
EKLAIAFTTHQPNHAVTVADKVLLMLPEATTIFGPTGAVLTETNLEALYGIPVRSARIGD
NEREETTFAPLFRSRKRKGISA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggtctctgatccccccaagctgcgcataacggaggccagccagtcgtatgacggacgc
cgatggcaattccgcggtctcgatctcgacctgaagtcaggcgagatcacggtcattctc
gggccgaacgggcgtgggaaatccacgctgctgcgtgtgctggcaggggttctgaaaccg
acatccggggagctccagctcaacccttgtacgggcttcgtgccgcaggagttctcaggc
tcctttccctatacggtccttgacaccgtgcttatgggccgagcgcgtcacgtcggcctg
tttcggactccaagcaagatcgacatcgacaaggcgatggacgccctgaacgccaccgga
atgtccggctttgcgtcgcgcaacatcgatgcactttccggtggcgaacgccaactcgtg
ctcatcgccagggcgctcgccggcgaaaacgaagtcttgcttctcgacgagcccgcatcg
gcgctcgacctcaagaaccaggacaaggtgctggcgttgatcggcgacttggcggaccgg
gaaaagctcgccatcgccttcaccacgcaccagccaaaccatgccgtgacggtggctgac
aaggttctcttgatgttgccggaagcaacaacgattttcggcccgaccggcgcggtgctg
acggagaccaatctggaagctctctatggcattcccgtccgctcggcccgcatcggtgac
aatgagcgcgaggagaccaccttcgcaccgctttttcgcagccggaaacggaaagggata
agcgcatga

DBGET integrated database retrieval system