KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5710Help
Entry
Rleg2_5710        CDS       T00779                                 

Definition
(GenBank) GntR domain protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR HTH_11 HTH_Crp_2 HTH_36
Motif
Other DBs
NCBI-ProteinID: ACI58885
JGI: Rleg25710
UniProt: B6A3A2
Position
pRLG202:110262..110987
Genome map
AA seq 241 aa AA seqDB search
MDVRAMLEEVATLGGAPKKSMKDFVVQKIATFIATGILKAGDPLPSERELAAALSVSRET
VRGAILILSTHGILSVAQGTRTVVASEDVGELAVQAARYRDIAAYSLDNVHEARLLIEAQ
VVRAAAVKMEEATLDYLRKSIAAQEAACDDPVRFLICDREFHTAIYRSSGNAVLADMAAD
LYSYLLSHRRRVVSQPGTIATSIADHRLILAGLETRDPDAACAAFAIHETRIYTTTKLLL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggatgttcgagcgatgctcgaagaggttgcgacgcttggcggcgcaccgaagaagtcg
atgaaagacttcgtcgtccagaagattgcgaccttcatcgccaccggcatcctcaaagcc
ggcgacccgctgccgagtgaacgtgagctggctgccgcgctctcggtcagccgcgagacc
gtccgcggtgcgatcctcattctctccacgcatggaattctctcggttgcgcagggaacg
cgcacggtggtggcatctgaggatgtcggcgaattggctgtccaggcggcgcgttatcgc
gacattgcggcctacagtctcgacaatgttcatgaggcgcggctgctgatcgaagcacaa
gtggtcagggctgccgcggtcaagatggaagaggcgacgcttgattatctccgcaagtcg
atcgcggcacaggaagccgcctgtgacgatcccgtccgtttcttgatctgtgaccgtgag
tttcacaccgccatctaccggtccagcggcaatgcggtgctcgccgacatggccgccgac
ctctattcctatcttctcagccaccgcaggcgcgtcgtatcgcagcctgggacgatcgcc
acgagcattgccgatcaccggttgatcctcgccggtctggagacgcgggatccggatgcc
gcatgcgcggccttcgcgatccatgaaacccgcatttataccacaaccaagctgctcctc
gcgtag

DBGET integrated database retrieval system