KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5712Help
Entry
Rleg2_5712        CDS       T00779                                 

Definition
(GenBank) ABC transporter related
  KO
K10112  
multiple sugar transport system ATP-binding protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
ABC transporters
Module
Raffinose/stachyose/melibiose transport system
Putative sorbitol/mannitol transport system
alpha-Glucoside transport system
Putative multiple sugar transport system
Glucose/mannose transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rleg2_5712
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    Rleg2_5712
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    Rleg2_5712
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    Rleg2_5712
   alpha-Glucoside transporter [MD:M00201] [OT]
    Rleg2_5712
   Glucose/mannose transporter [MD:M00605] [OT]
    Rleg2_5712
   Cellobiose transporter [MD:M00206] [OT]
    Rleg2_5712
   N,N'-Diacetylchitobiose transporter [MD:M00606] [OT]
    Rleg2_5712
   Putative fructooligosaccharide transporter [MD:M00197] [OT]
    Rleg2_5712
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    Rleg2_5712
   Arabinosaccharide transporter [MD:M00602] [OT]
    Rleg2_5712
   Putative multiple sugar transporter [MD:M00207]
    Rleg2_5712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:112180..113247
Genome map
AA seq 355 aa AA seqDB search
MAGVQFADVRKSFGVHPVIRGVDIDIADGEFVILVGPSGCGKSTLLRMLAGLENISGGEI
KIGGRVVNTLPPKDRDIAMVFQNYALYPHMTVEQNMGFSLMLNKAPKAEAEKRVKYAAGI
LGLDKLLDRYPRQLSGGQRQRVAMGRAIVRDPEVFLFDEPLSNLDAKLRVAMRAEIKELH
QRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGSPLELYDKPANLFVGGFIGSPAMN
MIKGRLDPEDARQFVAANGTRLPVANPPASAVGRELVYGLRPEYISLDPNGVPAEIVVIE
PTGYETHLTVRLGGSDVSCVFRERVNARPGEAIRVAIDASHVHLFDAEGGQRLTD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgttcaattcgcggatgtgcggaaatcgttcggtgtgcatcctgtcatcagg
ggggtagatatcgacattgccgatggggaattcgtcatcctggtcggcccctcgggctgc
ggcaagtccacccttctgcggatgctggcagggctcgaaaacatttccggcggcgagatc
aaaatcggcgggcgcgtcgtcaacacgctgccgccgaaggaccgggacatcgccatggtg
tttcagaactatgcgctctatccgcatatgacggtggagcagaacatgggcttctcgctg
atgctgaacaaggcgccgaaggcggaagccgaaaagcgggtgaaatatgccgccggcatc
ctcggcctcgacaaattgctcgaccgttatccacgtcagctttccggcggccagcgccag
cgtgtcgcgatgggccgggcgatcgtacgcgatccggaggtcttcctgttcgacgagccg
ctgtccaacctcgatgcgaaactgcgcgtcgccatgcgcgccgagatcaaggaactgcac
cagcggctgaaaaccaccacggtttacgtcacccacgaccagatcgaggccatgaccatg
gccgacaagatcgtcgtcatgcatgacggcatcgtcgagcagatcggttcgccgctcgag
ctttacgacaagccggccaatctcttcgtcggcggcttcatcggctcgccggcgatgaat
atgatcaagggcaggctcgatccggaagacgcccgccagttcgtcgccgccaacggcacg
cggctgcccgtcgccaatccgccggcaagtgcggtggggcgcgaactcgtctatgggctg
cgccccgaatatatctcgctcgatccgaacggcgtgccggccgagatcgtggtgatcgaa
cccaccggctatgagacccatctgaccgttcgcctcggcggcagcgatgtcagctgcgtg
ttccgggagcgtgtcaatgcccgcccgggcgaggcgatccgcgtggcgatcgacgcttcg
cacgtccatctcttcgatgccgaaggcggacagagattgaccgactga

DBGET integrated database retrieval system