KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5724Help
Entry
Rleg2_5724        CDS       T00779                                 

Definition
(GenBank) flavin reductase domain protein FMN-binding
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:124598..125137
Genome map
AA seq 179 aa AA seqDB search
MSATAALGIAPAPAPISDAFRSTMRRFPATVTVISACRNGADHGMTATAVTSLSMDPPSL
IICLNNRTYLHDMLLEVPEFAVSILTDRQAAVSEGFSGKIAPERRFDAADWVRHERGMMV
LDSAHASVICRRTGAVPYGTHTIFIGQVVDTRLSQDTIALMYENSKYCAPLHALPASQN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccactgctgccctcggcatagcgccggcccccgcacccatcagcgatgcgttt
cgatcgaccatgcgccgcttcccggcgacggtgacggtcatttctgcctgccgcaacggt
gcggaccatggaatgacggcaaccgccgtcacatcgctttcgatggatccgccatctctc
atcatctgcctgaacaatcgcacctacctgcatgacatgctgcttgaggtgccggaattc
gcagtcagcattctgaccgacaggcaggcagccgtatcggaaggtttcagcggcaagatt
gcgcctgagcgtcggttcgacgctgccgactgggttcgccacgagcgcggcatgatggtg
ctggattccgctcatgcctcggttatctgccgccgcacgggcgctgttccttatggaacg
cacacgatcttcatcgggcaggtggtggatacacgcctttcccaagacacgatcgcactg
atgtacgagaactcgaaatattgcgcgccactgcacgcacttcctgcatcccagaactga

DBGET integrated database retrieval system