KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5726Help
Entry
Rleg2_5726        CDS       T00779                                 

Definition
(GenBank) amidohydrolase 2
  KO
K20941  
gamma-resorcylate decarboxylase [EC:4.1.1.103]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Benzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rleg2_5726
Enzymes [BR:rlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.103  gamma-resorcylate decarboxylase
     Rleg2_5726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:126428..127408
Genome map
AA seq 326 aa AA seqDB search
MQGKIALEEHFAIPETLQDSAGFVPGDYWTELSARLLDIQDKRLRLMDTHGIEKMILSLN
APAVQAIPDKAKAVEISRRANDFLAEQCVKNPNRFLGFAALPLQDPDAATQELQRCVTTM
GFVGALVNGFSQEGDGTTPLYYDLPQYRPFWAEVEKLDVPFYLHPRNPLPQDSRIYAGHS
WLMGPTWAFAQETAVHALRLMGSGLFDEHPALRIIVGHMGEGLPYMMWRIDNRNAWVKVE
KSYPAKRPIADYFNENFYITTSGNFRTQSLIDAMLEIGADRILFSADWPFENVDHAANWF
DSATISEADRLKIGRTNAVSLFKLDR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaggcaagatcgcgcttgaagaacatttcgccattcccgagacgctgcaggattcg
gctggattcgtgccgggcgactattggacggaactgtccgcccgtctgctcgatattcag
gacaaacgtttgcggctgatggatacgcacggcatcgagaaaatgatcctgtcgctgaac
gctccagccgtgcaggcgatcccggacaaggcaaaggccgtcgagatttcccgacgcgcc
aacgactttctggcggagcaatgcgttaagaacccgaaccgtttcctgggatttgcggct
ttgcccttgcaggatccggacgctgctacgcaggaattgcagcgctgcgtgacaacgatg
ggtttcgtcggcgcactggtcaatggcttctcgcaggaaggcgacggaacgacgccgctc
tactacgacctgccgcaatatcgcccgttctgggccgaagtcgaaaaactcgacgttcct
ttctatctgcatccgcgcaacccgctgccgcaggatagccggatctatgcgggccattcc
tggctgatgggtccgacatgggcgttcgcgcaggagaccgctgttcatgcattacgcttg
atgggatccggcctgtttgacgaacatccggctttgcggatcattgtcggccacatgggc
gagggactgccatatatgatgtggcgcatcgataaccggaatgcgtgggtcaaggtggaa
aagagttatccggcaaaacgcccgattgccgattatttcaacgagaatttctacatcacg
acgtcggggaatttccgcacgcaatcgcttatcgatgctatgctcgaaatcggcgcggac
agaattctgttttcggcagactggccattcgagaacgtcgaccatgctgcaaactggttc
gacagcgccaccatctccgaagccgaccgtctgaagatcggtcgcaccaatgccgtttca
ctgttcaaactcgatcgataa

DBGET integrated database retrieval system