KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5727Help
Entry
Rleg2_5727        CDS       T00779                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:127410..128468
Genome map
AA seq 352 aa AA seqDB search
MVAPFRYTVGAAQIIFGRGSLSRLAEAIAGQGGTRALILSTQHQKAEAERIAASLGPLAA
GLFADAAMHTPVDVTERAMAAYNRAGADCVVAIGGGSTIGLGKAIAYRNDAPQIVVATTY
AGSEVTPILGQTENGQKTTVRGPGILPEVVIYDPELTLGLPVNISVSSGLNAMAHAVEGL
YAQDRNPISSMMAIEGLHALKQALPQIVNTPGDIESRSEALYGSWLCGTVLGAVGMALHH
KLCHTLGGSFDLPHAETHAVILPHSAAYNAVAATDALKPAADLFGGSLGGGLYDFAASIG
APMRLRDLGMKEADLHPAAELAARNPYWNPRPIERDAIRALLQSAWEGARPR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcacctttcagatatacggtcggcgcggcccagatcatcttcgggaggggctcg
ctcagccgtctcgccgaggcgattgcagggcagggcggcacgcgcgccctgatcctttcg
acccagcaccagaaagcggaagctgaacgcatcgccgcttccctcggcccgctggcggcg
ggactattcgccgatgctgcgatgcatacgcccgtcgatgtcaccgagcgcgcgatggcg
gcatacaatcgagccggcgccgattgcgtcgtcgcgatcggcggcggatcgacgattggt
ctcggcaaggcaatcgcctatcgcaacgacgcgccgcaaatcgtggtggcgacgacctat
gcggggtcggaggttacaccgatcctcggccagacggagaacggccagaagacgacggtc
cgcgggccgggcatcctgcccgaagtggtgatctacgaccctgaattgacattgggatta
ccggtcaacatcagcgtcagcagcgggctcaatgcgatggcgcatgccgtcgaaggtctc
tacgcacaggatcgcaatccaatttcgtcgatgatggccatcgagggcttacacgcgctg
aagcaggctttaccgcaaatcgtcaatacgcccggggacatcgaatcgcgaagtgaagcg
ctttacggatcctggctgtgcggcacggtgctcggtgcagtcggaatggccctgcatcac
aagctttgccatacgctgggcggcagtttcgatctgccgcatgcagaaacccatgcggtc
attcttccccattccgccgcctacaacgccgtagccgcaacggatgcgctaaagcccgct
gccgatcttttcggcggctcgctcggcggcggtctttatgattttgccgcctcgatcggt
gcacccatgaggctgcgagatctgggtatgaaggaagccgacctgcaccctgcggcggaa
ctcgccgcccggaacccttactggaacccgcgcccgatcgaacgggacgcgatccgggct
ttgttgcagagcgcctgggagggcgcgcggccgcgttga

DBGET integrated database retrieval system