KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5729Help
Entry
Rleg2_5729        CDS       T00779                                 

Definition
(GenBank) YCII-related protein
  KO
K09780  
uncharacterized protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:129337..129633
Genome map
AA seq 98 aa AA seqDB search
MIVVRYAVSDPGKAAERSRLLEQHKAYLYGAAIRILLSGPSAPPAEGKGSTAVVIADVET
LAEFETFSAGDPFVRAGVYRSVDVFEWRPSFGLLLDSL
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgtccgctatgcagtatcagatcccggcaaggctgccgaacgttcccgattg
ctcgagcaacacaaggcctatctgtacggcgcggcgatccgcatcctgctttccggtccc
tctgcaccgccggcagaaggaaagggttctaccgccgtggtgatcgcggacgtcgaaacg
ctggccgagttcgagacgttcagcgcaggagatcccttcgtccgcgccggcgtttacagg
agcgtcgatgtattcgaatggcggcccagttttgggcttctgctggacagtctttga

DBGET integrated database retrieval system