KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5732Help
Entry
Rleg2_5732        CDS       T00779                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(130876..132081)
Genome map
AA seq 401 aa AA seqDB search
MARVRIQDNVLVAVMIACVGTCYGFGLSLFPQIIPDMRKDLAFDYAFVGTVTGLVQFSTV
AFAVLGTWLVHRIGAARTVVASVSLCGLCLSSIPISDNLYVVAGLLMVAGATGASTFVPM
INLASRVVRAEQRGFAMSLISSAPAFGVLINSALVAAYAGSGHWQMVWFLTGAATIALAV
VTHILFGRAGLFDSGTSHETLAPTAGGSASLRSIMPWVTLIFALGFINGLMPYPYLTYLS
PFLREELGYSVGFASWLWATIGAVGISAGFAIGTISSRLGSRYAMLTCYSSFLAAGALVV
LEPSMELSILSGVFFSLGFYPIYGLLPAYVSHRATPRVAVTVLGICTVFQGIGGTTGNFF
GGVIKTSTESFSGIYLAVAVTAAVAAAMTISLPKDQRVQAV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctagagtgcgtatccaggataacgtcctcgtagccgtcatgatcgcctgcgtcggc
acatgttacggattcggcctcagcctttttcctcagatcatccccgacatgcggaaagat
cttgccttcgactatgccttcgtcggcacggtcaccggcctggtgcagttttccacagtg
gcattcgccgtgctcggtacctggctcgtccatcgcatcggcgccgcacggacggtggtg
gcgtccgtctcgctctgcgggctctgcctgtcgagcatccccatcagcgacaatctctat
gtggttgccggcctgctgatggtcgccggcgcgactggcgcatcgactttcgtgccgatg
attaatcttgcctcgcgggtggtaagagcagaacagcgcggctttgccatgagcctgatc
tccagcgccccggcctttggcgtcctcatcaacagcgcactcgtggcggcatacgccgga
agcggtcactggcagatggtctggttcctcacgggcgcggccacgatcgcactggccgtt
gtcacccacattctcttcgggcgggccggcctcttcgacagcgggacaagtcacgaaacg
ctggcgccaactgccggcggttcagcaagcctgcgctccatcatgccatgggtgacgctg
atcttcgcgctcggcttcatcaacggcctgatgccatacccctatctcacctatctctcg
ccgttcctgcgcgaggagctcggctattccgtcggctttgcctcatggctctgggcaacg
atcggggcggtggggatcagcgcaggcttcgccattggcacaatatcgtcgcgtctcgga
tcgcgctatgccatgctgacctgttactcaagcttcctcgccgccggcgccctcgtcgtc
ctcgaaccctcgatggaactctcgatcctgtccggcgtcttcttttcgctgggcttttat
ccgatctatggcttgctgccggcctacgtctcacatcgggccacaccccgcgtcgcggtg
actgtcttaggcatctgcaccgtgttccaaggcatcggcggcacgacagggaacttcttt
ggcggcgtgatcaagacatcgactgaaagtttcagcggcatctatctcgccgttgcagtt
acggccgccgtcgccgcggcgatgacgatctcgctgccgaaggaccagcgtgtgcaggcc
gtgtag

DBGET integrated database retrieval system