KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5759Help
Entry
Rleg2_5759        CDS       T00779                                 

Definition
(GenBank) pyridoxal phosphate-dependent enzyme
  KO
K01042  
L-seryl-tRNA(Ser) seleniumtransferase [EC:2.9.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Selenocompound metabolism
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rleg2_5759
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rleg2_5759
Enzymes [BR:rlt01000]
 2. Transferases
  2.9  Transferring selenium-containing groups
   2.9.1  Selenotransferases
    2.9.1.1  L-seryl-tRNASec selenium transferase
     Rleg2_5759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(164162..165358)
Genome map
AA seq 398 aa AA seqDB search
MPNDIRPSLGLRPVINVSGTMTSLGASIVVPEAIEAMASILPHFVEINDLQRKASAVIAR
LTGGEAGFVTASCSAGISLAVAGAITGDNLLAIEKLPDAVSEKNEVLVQMGHVVSYGAPV
DQAIRLAGGKVVLVGQATSTHRFHMEKAITDKTAAAVFVVSHHVVDYGLLNLKEFVEIAH
ARGVPVIVDAASEYDLRIFLEQGADIALYSGHKFLGGPTSGIVAGRKELVRHAFLQNMGI
GRGMKVGKESIFGVMAALEAWEKRDHAGIRERETSSLNLWKRTLDGRPGVSALIEPDPTN
NPLDRLRLIVDPEQAHITAWDLADALARGDPPIIVRDHEVEHRYFYLDPCNLHPGQDVIV
ANRLAEELDKARASNEIIATPIENRSRHRFDGVLRWPD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgacatcagaccttcgctcggccttcgccccgtcatcaacgtatccggcacg
atgaccagcctcggcgcttcgatcgtcgtgccggaggcgatcgaggcgatggcgtcgatc
ctgccgcatttcgtcgagatcaacgacctgcagcgcaaggcaagcgccgtcatcgcccgg
ctgaccggcggcgaggccggcttcgtcaccgcttcctgctcggccggcatttcgctggcc
gtcgccggcgccatcaccggcgacaatctgctggcgatcgagaagctgccggatgccgtg
tccgagaagaacgaagtgctggtgcagatgggccatgtggtgagctatggcgcccccgtc
gaccaggcgatccggcttgccggcggcaaggtcgtgcttgtgggacaggcgacctcgacg
catcgctttcacatggaaaaggcgatcaccgacaagaccgccgcggccgtctttgtcgtc
tcccaccatgtcgtcgattacggcctgctgaacctcaaggaattcgtcgagatcgcccat
gccaggggtgtgcccgtcatcgtcgatgcggcatcggaatacgacctcaggattttcctg
gagcagggggccgatatcgccctttactccggccacaagttcctcggcggcccgacctcg
ggcatcgttgccggccggaaggagctggtgcgtcatgccttcctgcagaacatgggcatc
ggccgcggcatgaaggtcggcaaggagagcatcttcggcgtcatggccgcactcgaagcc
tgggaaaagcgcgatcacgccggcatccgcgagcgcgagaccagctctctcaatctgtgg
aagcgcacactcgacggccgtcccggcgttagcgcgctgatcgagcccgatccgaccaac
aatccgctcgaccggctgcgtctcatcgtcgatcccgagcaggcgcatatcaccgcctgg
gatctggctgatgcgctggcgaggggcgacccgccgatcatcgtgcgcgatcacgaggtg
gagcaccgctatttctatctcgacccgtgcaacctgcatccgggccaggatgtcatcgtt
gcaaaccgcctggccgaggaactcgacaaggcgcgcgcctccaacgagatcatcgcaacc
ccgatcgaaaatcgcagccggcaccgcttcgacggtgtgctgcgctggccggattga

DBGET integrated database retrieval system