KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5760Help
Entry
Rleg2_5760        CDS       T00779                                 

Definition
(GenBank) Endoribonuclease L-PSP
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(165428..165925)
Genome map
AA seq 165 aa AA seqDB search
MNQFPNAAGKVENSPYQRLAALGIKLPPPPPPIANFVTHVVEGNMLYLSGQGPREADGFL
HAGKVGANVGVDEAYRHARLTGINLLAVMHDALGDLSRVKRVVKLLGMVNAVPEFEDHPS
VINGCSDLLIAVFGAAGEHARSAVGFGSLPGNITVEIEAIVALNG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagtttcccaacgccgccggcaaggtcgagaattcgccttaccaacggttagcc
gccctcggcatcaagctgccgccgccgccgccgccgatcgccaatttcgtgacgcatgtg
gtggagggcaatatgctctacctctccggccaggggccgcgcgaggccgacggcttcctg
cacgccggcaaagtcggcgccaatgtcggtgtcgatgaggcttaccggcatgcgcggctg
accggcatcaatctgctcgccgtcatgcatgatgcgctcggcgatctctcccgcgtcaag
cgggtggtcaagctgctcggcatggtcaatgccgtgccggagttcgaggatcatccgagt
gtcatcaacggctgctcggatctgctgatcgccgtcttcggcgcggccggcgaacatgcc
cgctcggccgtcggcttcggctcgctgcccggcaacatcaccgtcgaaatcgaggcgatc
gtcgccttgaatggctga

DBGET integrated database retrieval system