KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5761Help
Entry
Rleg2_5761        CDS       T00779                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02034  
peptide/nickel transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5761
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Rleg2_5761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(165980..166849)
Genome map
AA seq 289 aa AA seqDB search
MADIAIKSAESEGSKFVRRLLKRKTVAFGLLILAIFVLLAVFAPVVAPYSPSKLSIVNRL
KPPGGAFFFGTDEFGRDVFSRTIFAGRLSLLVGVAVVSLSAVIGVTLGLLAGFFQKLDTP
IARLIDAMMAFPDILLAIALVAALGPSLTTVIIALSIVYAPRLARIVRASTLVIRELPYV
EAARALGISTFHIMIRHVLRNLLSPILVQATFLFASAMLAEAGLSFLGLGVSPEIPTWGT
MIAAGRQYIGQADWMTLFPGVAIILSVLSLQMVGDGLRDMLDPRLRKDL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatcgcaatcaaatcagccgagagcgaaggcagcaaattcgtccgccgcctg
ctgaagcgcaagacggtggccttcggcctgctgatcctggcgatcttcgtgctgctggcg
gtcttcgcccctgtcgttgcgccctattcgccctccaagctttccatcgtcaaccggctg
aagccgccaggtggcgccttcttcttcggcaccgacgagtttggccgcgacgtcttctcg
cggacgatctttgccggccgcctgtcgctgttggtcggcgttgcggtcgtcagcctgtcg
gcagtgatcggcgtgacgctcggccttctggccggctttttccagaagctcgatacgccg
atcgcccggctgattgatgcgatgatggccttcccggatattctgctggcgatcgccctc
gtcgccgccctcggcccgtccttgaccacggtgatcattgccctgtcgatcgtctatgcg
ccgcggcttgcccgtatcgtccgcgcctcgacgctggttattcgcgagttgccctatgtc
gaggcggcgagggcgctcggcatttccaccttccacatcatgatccggcatgtgctgcgc
aatctgctgtcgccgatcctggtgcaggccaccttcctctttgccagcgccatgcttgcc
gaagccggcctctccttcctcggcctcggcgtcagcccggaaattccgacctggggaacg
atgattgccgccggccgccaatatatcggccaggccgactggatgacgctgtttcccggc
gtcgccatcattctctcggtgctgtcgctgcagatggtcggcgacggcctcagggacatg
ctcgacccaagacttcgcaaggacctttaa

DBGET integrated database retrieval system