KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5764Help
Entry
Rleg2_5764        CDS       T00779                                 

Definition
(GenBank) protein of unknown function DUF1349
  KO
K09702  
uncharacterized protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:169616..170200
Genome map
AA seq 194 aa AA seqDB search
MNIDFNDGKWLNEPASWQADATGLTITTDEKTDFWRETHYGFTRDSGHFLAFPTTESFTA
QIRIQGEFRTLYDQAGLMVRLDESRWVKTGVEFTDDEAFLSTVITDGRSDWSVSQPFKEL
EDFRIRVTVANGALRIQASRDGRRWPLLRLAPFPAAGHYEVGPAACTPERSGLMVRFSEF
SIGPAITTDLHDLS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgacttcaacgacggaaaatggctgaacgaaccggccagctggcaagctgac
gcaaccggcctcacgataacgaccgacgagaaaaccgatttctggcgcgagacccattac
ggcttcacccgcgacagcggccacttcctcgcctttcccacgaccgagagcttcaccgcc
cagatccgcatccagggcgaattccgcaccctctacgaccaagccggcctgatggtgcgc
ctcgacgaaagccgctgggtcaaaaccggcgtcgaattcaccgacgacgaagccttcctc
agcaccgtcatcaccgacggccggtccgactggtcggtgtcgcaacccttcaaggagctg
gaggacttccgcatccgcgtcaccgtcgcaaacggtgccctgcgcatccaggcctcccgc
gacggccgccgctggccgctgctgcgcctagcgcccttccccgcggctggccactacgag
gtcgggcctgcggcctgcacgccggagcggagtgggttgatggtgcggttttcggagttt
tcgatcgggccggcgattacgacagatctgcatgatttgagttag

DBGET integrated database retrieval system