KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5766Help
Entry
Rleg2_5766        CDS       T00779                                 

Definition
(GenBank) hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(170637..171158)
Genome map
AA seq 173 aa AA seqDB search
MFRNKLVAAFCAVVTLPAPAFATDSTQMISTLERFNDGSGAQQLAIKLAGLVEKADWPGL
NALSKQIQDEDGPLLSELAGVGELGEAEQRKIALAMRPCQTANVLIRAIAIAIGDGRFQP
IVRGGTVMIDGTEVDSNFAKHMWTCEVLGQLPHKTSIGSKCLMTGACKDDPDL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaaataaattggtcgccgctttctgtgcggtcgttacgttgccggcgcctgcg
ttcgctacggattcgacgcagatgatatctacactcgaacggttcaacgacggcagcggc
gctcagcaattggcaatcaaactggccgggctggttgagaaggccgattggccgggtctg
aatgcgcttagcaaacaaatccaagacgaggatgggcctctgctttctgagctggcgggc
gtgggggagcttggagaggctgagcagcggaagattgcgctggccatgcggccatgccaa
accgcgaatgtgttgatcagagcaatcgccattgcgattggagacgggcggttccagccc
attgtcagaggcggaacggtcatgattgacggcacagaagttgattccaatttcgcaaaa
cacatgtggacgtgcgaggtcctcgggcaattgccccataaaacatcaatcggctccaaa
tgcctgatgactggagcttgcaaggatgaccctgacctgtga

DBGET integrated database retrieval system