KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5774Help
Entry
Rleg2_5774        CDS       T00779                                 

Definition
(GenBank) Invasion associated locus B family protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(185338..185952)
Genome map
AA seq 204 aa AA seqDB search
MKTFLKSSMKRGLRTSAPILISIACATPSFSQSPGTQEPEQVQAPTQSAPALKSQKFDDW
YYRCTGAAGAEACEVAQVAQVTKDGKPVNILTLAISAPPAAPSDKDKGKPRLMLTALLPL
NVFLPSGLSIRADGKPVAKLDYRNCNQTGCWAQLALDTKMTAALKKGAAAEGLVRLMNGQ
DVNIRFSLKGLKPALDELQSVAAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatttttgaaaagcagcatgaagcggggtctccggacgagtgcccccattctg
atatcgatcgcctgtgcgaccccatccttttcgcaatctcccggcacccaagagccggag
caggtgcaagcgccgacccaatcggcgccggcgctaaaatctcagaaattcgacgactgg
tattatcgctgcaccggtgcggccggcgctgaggcttgcgaagtcgcacaggtggcacaa
gtcaccaaggacggtaaacccgtcaatatcttgacgctggcgatatcggcgccgcctgcc
gcgccttccgacaaggacaagggcaagccacggctgatgctgaccgcccttctgccgctc
aacgttttcctgccctcgggcctgtcgatcagggccgacggcaagcccgtcgccaagctc
gattaccgcaactgcaaccagaccggatgctgggcgcagctggcgctggatacgaagatg
accgcggcgctgaagaagggtgcggccgccgaagggctggtgcggctgatgaatggccag
gacgtcaatatccgcttctcgctgaaggggctgaagccggccctcgacgaacttcagtcc
gtcgccgcgaagtag

DBGET integrated database retrieval system