KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5775Help
Entry
Rleg2_5775        CDS       T00779                                 

Definition
(GenBank) Hydroxyethylthiazole kinase
  KO
K00878  
hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rleg2_5775
Enzymes [BR:rlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     Rleg2_5775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:186747..187550
Genome map
AA seq 267 aa AA seqDB search
MQSRTTPGAMLTAMREKPPLVQCITNYVAMNIAANVLLAAGASPAMVHAAEEADEFAGIA
SALTVNIGTLSTQWIDGMQAAAKATTAAGKPWVLDPVAHYATAFRRDAVAGLLALKPTII
RGNASEIIALAGGESRGQGVDSRDPVEQAEGSARWLAERQQAIVAVTGAVDFVTDGERAV
RITGGSALMPQVTALGCSLTCLVGAFAATAPEDLFGATVAALATFAIAGEEAALGAAGPG
SFAWRFLDALHALDAETLDARARISAA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaggaccacaccaggagccatgctgacggcgatgcgcgagaagccgccgctc
gttcagtgcatcaccaattacgtggcgatgaacatcgctgccaatgttctcctggccgcc
ggcgcctcgcccgccatggtgcatgcggctgaagaagccgacgaattcgccggcatcgcc
agcgcgctgacggtcaatatcggcacgctgtcgacgcaatggatcgacggcatgcaggcg
gccgcgaaggcaacaaccgcggccggcaaaccctgggtgctcgatccagtcgcccattat
gccacggctttccgccgcgatgcggtcgccggtctgctggcgctcaagccgacgatcatc
cgcggcaacgcttccgagatcatcgctcttgccggcggcgagagccgcggccagggcgtc
gacagccgcgatccggtcgagcaggccgaagggtcggcgcgatggcttgctgagcgccag
caggcgatcgtcgccgttaccggtgctgtcgatttcgtcaccgacggcgagcgggcggtg
cgcatcacaggcggatcggccttgatgccgcaggtcaccgcgctcggctgctcgctcacc
tgcctggtcggcgcctttgccgcaaccgcgcccgaggatctgttcggggcgacggtcgca
gcccttgcaaccttcgccatcgccggtgaggaggcagcactcggtgcggccggtcccggt
tcctttgcctggcgcttcctcgatgcactgcacgcactcgacgctgaaacgctcgatgcc
agggcaaggatatcggcggcatga

DBGET integrated database retrieval system