KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5776Help
Entry
Rleg2_5776        CDS       T00779                                 

Definition
(GenBank) thiamine-phosphate pyrophosphorylase
  KO
K00788  
thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rleg2_5776
Enzymes [BR:rlt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     Rleg2_5776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:187547..188182
Genome map
AA seq 211 aa AA seqDB search
MKTFDLSLYLVLDPDLCAGIGMVETARRAVAGGATMVQLRDKHAGTTAMIETGRALKQAL
DGTGARLIVNDDVEAAIAIGADGLHIGQEDMDAVRARAMIGPDMILGLSVETAALAASVD
PSLVDYTGIGPVFATPTKADHKQPIGFHGLARLVAASPVPSVAIGGLKAEHVAKVFAAGA
SGLAVVSAISGTPDPEAATRRIAAEIRKARA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcgatctttcgctctatctcgtgctcgatcctgacctctgcgccgggatc
ggcatggtcgaaacggcgcgccgtgccgttgccggcggcgcgacgatggtgcagttgcgc
gacaaacatgccggcacgaccgcgatgatcgagaccggccgcgccttgaaacaggccctt
gatggcaccggcgcccgcctcatcgtcaacgacgatgtcgaggcggcgatcgccatcggc
gccgatgggttgcatatcggccaggaggacatggatgcggtgagagcgcgggcgatgatc
ggccccgacatgatcctcggcctttcggtcgagactgcggcacttgccgctagcgtcgat
cccagcctcgtcgattataccggcatcgggccagtgtttgcgacgccgaccaaggccgac
cacaagcagccgatcggttttcacggcctggcaaggctggtggcggcttcgccggtgccg
tcggtcgcgatcggcggcctcaaggcggagcatgtggccaaagtgtttgccgcgggcgcc
agcgggcttgccgttgtctccgccatctcaggcacgccggacccggaagcagccacgcgc
cgcatcgccgcagaaattcgaaaggcccgagcatga

DBGET integrated database retrieval system