KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5790Help
Entry
Rleg2_5790        CDS       T00779                                 

Definition
(GenBank) choline-sulfatase
  KO
K01133  
choline-sulfatase [EC:3.1.6.6]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.6  choline-sulfatase
     Rleg2_5790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:199592..201106
Genome map
AA seq 504 aa AA seqDB search
MARPNILILMVDQLNGTLFPDGPADFLHAPHLKSLAERSVRFANTYTASPLCAPARASFM
SGQLPSRTRVYDNAAEFASDIPTYAHHLRAAGYQTALSGKMHFVGPDQLHGFEERLTTDI
YPADFGWTPDYSKPGERIDWWYHNLGSVTGAGVAEITNQMEYDDEVAYNATRKLFDLSRA
HDGRPWCLTVSFTHPHDPYVARRKFWDLYEDCPALDPAVAPIAFERQDPHSQRLMKACDH
EAFAISPEGIRRARRGYFANISYVDEKIGDILGVLERTRMAENTIILFVSDHGDMLGDRG
LWFKMNFFEGSARVPLMIAAPGWKPGRIDHPVSTLDVTPTLAGLAGIDITALKPWTEGED
LAGLAEGTGSRGPVPMEYAAEGSEAPLVCLRDGRYKLSLCDKDPPMLFDLEADPQELDNL
AGNPAHAGTLARLADQAGRRWNLADFDAAVRESQARRWVVYAALRNGAYYPWDYQPLQKA
SERYMRNHMDLNVLEENQRFPRQE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcccgaatattctcatcctgatggtggatcagctgaacgggaccttgtttccc
gacgggcctgccgacttcctgcatgcgccgcatctgaaatcattggccgagcgttccgtg
cgcttcgccaacacctatacggcgagcccactctgcgcaccggcgcgggcgtccttcatg
tccgggcaattgccgagccggacgcgcgtctacgacaatgccgccgaattcgcctccgat
attccgacctatgcgcatcatctgcgcgccgccggatatcagacggcgctgtcgggcaag
atgcatttcgtcggccccgaccaacttcatggcttcgaggagcggctgacgacggatatc
taccccgccgatttcggctggacgcccgattatagcaagcccggcgagcgcatagactgg
tggtatcacaatttgggttcagtgaccggcgccggcgttgccgagatcaccaaccagatg
gaatatgacgacgaggtcgcctacaacgccacccgcaagctgttcgatctctcacgcgcc
cacgacgggcgcccctggtgcctgaccgtcagcttcacccatccgcacgacccctatgtc
gcacgccgcaaattctgggacctctatgaagactgcccggcgctcgacccggcggtggcg
ccgattgccttcgagcgacaggacccacattctcagcggctgatgaaagcctgcgaccac
gaggctttcgccatcagcccggaaggaatccggcgggcaaggcggggctacttcgccaat
atctcctatgtcgacgagaagatcggcgacattctcggcgtgctggaacggacccgcatg
gccgagaacacgatcatcctcttcgtttccgatcatggcgacatgctcggcgaccgcggc
ctctggttcaagatgaacttcttcgaagggtcggcgcgcgtcccgctgatgattgcggca
cccggctggaagcccgggcgcatcgatcatccggtctccaccctcgacgtcaccccgacg
ctcgccggtcttgccgggatcgacatcaccgcgttgaaaccctggaccgagggcgaggat
ctcgcgggcctcgccgagggcaccggcagccgcggtcccgtgccgatggagtatgccgcg
gaaggttccgaagcgccgctcgtctgcctcagggacgggcgctacaagctttccctctgc
gacaaggacccgccgatgctgttcgacctcgaagccgatccgcaggagctcgacaatctg
gcaggaaatccggcgcatgccggcactctggcgaggctcgccgaccaggccggccggcgc
tggaacctggccgatttcgatgcagccgtgcgcgaaagccaggcgcgccgctgggtggtc
tatgcggcgctgcgcaacggcgcctattatccctgggactatcagcctctgcagaaggcc
tcggaacgctacatgcgcaaccacatggacctgaacgtgctcgaggaaaaccagaggttt
ccgcgccaggaatga

DBGET integrated database retrieval system